KEGG   Anolis carolinensis (green anole): 100557159
Entry
100557159         CDS       T01608                                 

Gene name
sesn3
Definition
(RefSeq) sestrin 3
  KO
K10141  sestrin 1/3
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100557159 (sesn3)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 100557159
NCBI-ProteinID: XP_016848170
Ensembl: ENSACAG00000013850
LinkDB
Position
3
AA seq 494 aa
MNRGSSAASCPASAPGDSQGSGLGRRVCSNCRKVLRQEKKIRVSLPLTRGPSAFIPEKEV
MQANSLNERMHLLVEEFSTSGRLDNITRVMGLHTQYLESFLRSQFYMLRMDGPLPLPYRH
YIAIMAAARHQCSYLINMHVDEFLKTGGIPEWLNGLEYVPQRLKNLNEINKLLAHRPWLV
SKEHIQQLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDLDTSNGYRLISV
NNFCVCDLANDNNIENSSLTSNNFEISDSLSELEALMDRMKRLQEEKEEEEEEASQEEMD
TRFEKEKTESLLVVTEAFDDEIGSIADVSRYVEDPGFGYKDFGRRGDLPTFRAQDYTWEN
HGFSLVNRLYTDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMYGIRYD
DYDYGEVNQLLERNLKVYIKTVTCYPERTTKRMYDAYWRQFKHSEKVHVNLLLMEARMQA
ELLYALRAITRHLT
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaaccggggaagtagcgctgcttcctgcccggcctcggcgcccggagacagccaggga
agcgggctaggccgccgggtctgtagcaactgcaggaaagtcctgaggcaggaaaagaaa
atcagagtgtctctgcctttaacaagaggaccaagtgcctttatacctgaaaaggaagtt
atgcaagccaacagtttgaatgaacgtatgcacctgcttgtggaagagttttctacatct
ggtcgcctagataacatcacccgggtcatgggcttacacacacagtacctggagtctttc
ctccgcagccagttttatatgttgcgtatggatgggcctcttcctttgccctaccggcac
tacatagcaatcatggctgctgccaggcaccagtgttcctacctaataaacatgcatgtg
gatgagtttctgaagactggagggatcccagaatggctgaatggcttggaatatgttcca
caaaggctgaaaaatctgaatgaaatcaataagcttcttgcacatcgaccctggctagtt
tcgaaagagcatattcagcaacttgtcaagacaggggaaaataattggtctcttcctgaa
ctggtgcatgctgtggtcctcttggcgcactatcatgccttggcaagttttgtctttggt
agtggcatcaatccagagagagatctggatacctcgaatggctacaggctcatatcagtt
aacaacttctgtgtctgtgatcttgccaacgacaacaacattgaaaattcatccctcaca
agtaacaactttgagatctcagattctctaagtgagctggaggctctgatggacagaatg
aagaggctacaggaggagaaggaagaggaggaggaggaagcctcccaggaggaaatggat
actcgctttgaaaaggagaagacagagagcctcctagttgtcactgaagcatttgatgat
gaaattggttccatagcagatgtttcccgctatgttgaagaccctggatttggatacaaa
gactttggtagacgtggagatctgccaacattccgagcccaggactacacctgggaaaat
catggattctcccttgtaaacaggctttatactgacatcgggcatctcttggatgagaaa
tttcggatggtctacaacctcacttacaatactatggccacccatgaagatgttgacaca
accatgttgagaagagctttatttaattatgtccactgtatgtatggaatcaggtatgat
gactacgattatggagaagttaatcagttacttgaacggaacttgaaagtttacattaaa
acagtgacctgctacccagagcgaaccaccaagcgcatgtacgatgcttactggcgtcag
ttcaagcattcagagaaggtccatgtgaatcttcttcttatggaggctcgcatgcaagct
gaactcctctatgcccttcgtgccatcacacgtcacttgacctga

KEGG   Anolis carolinensis (green anole): 100562336
Entry
100562336         CDS       T01608                                 

Gene name
sesn1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100562336 (sesn1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 100562336
NCBI-ProteinID: XP_003215685
Ensembl: ENSACAG00000006083
UniProt: G1KF20
LinkDB
Position
1
AA seq 549 aa
MAEARWDGLRSRDAADREAALDSLRLAVLKASEAVAKAGHEQEQKEGSPGGSAPSAPGPR
LNAMLARLLMLSKRCPFRDVREKSQAILGSVQELGIRIPRPLGQGPSRFIPEMEILQMSA
EDPQMHALFAESFTTLGHLDNITLIMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGI
MAAARHQCSYLVNLHVNYFLNVGGDPKWLNGLENAPQKLQNLGELNKILAHRPWLITKEH
IEHLLKTDEHSWSLAELIHAVVLLTHYHSLASFTFGCGINPEIHCDGGHTFRPPSVSDYC
ICDITNGNHGAYEAQGPAANCTTTEPLCEVEALMEKMKQLQESRDETTASQEEKATRFEK
EKRESMLVGCSEDEELAATRDVSRHFEDTSYGYKDFSRHGTHVPTFHVQDYSWEDHGYSL
VNRLYPDVGQLIDEKFQIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYG
EINQLLDRSFKIYIKTVVCAPERTTSRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYA
LRAITRYMT
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggctgaggcgaggtgggacgggctccggagccgggacgcagccgacagggaggccgcc
ctcgacagcctcaggctcgccgtcctcaaggccagcgaggcggtggccaaagcggggcac
gagcaggagcagaaggagggcagcccgggagggtccgctccctcggccccggggccccgc
ctcaacgccatgctggcccggctcctcatgctctccaagcgctgccccttcagggacgtc
cgggagaagagccaggccatcctcggcagcgtccaggaacttggcattaggatccctaga
ccactggggcaaggaccaagcagattcatcccagaaatggagattctccaaatgagtgct
gaagatccccaaatgcatgctctgtttgcagagtctttcacaactttagggcatttggac
aacattaccttgatcatggttttccatcctcaatatctggagagctttctgaaaactcag
cattatctgttgcagatggatggtccgctgcctcttcactatcgacactacataggtatc
atggctgcagctaggcatcagtgctcctacttggtcaacctccatgtcaattactttctg
aatgttggtggggatcctaagtggctgaatggtctagagaatgcacctcaaaaacttcag
aatttgggtgaattgaataaaatcctggcacacagaccatggcttattaccaaagaacat
attgagcatcttctgaagactgatgaacatagctggtcattagcagagctgatccatgct
gtagttctccttacacactatcattcactcgcctctttcacctttggttgtgggatcaat
ccagaaattcattgtgatggtggtcacacattcaggcctccttctgttagtgattattgc
atttgtgacattacaaatggaaaccatggtgcatatgaggcacagggtccagctgcaaat
tgtacaaccacagagcctttgtgtgaagtagaagcacttatggaaaaaatgaagcaactg
caggaatccagagatgaaactacagccagtcaagaagaaaaggccactcggtttgagaag
gagaagagggaaagcatgttggtgggttgttcagaggatgaagaattggcagcaacaaga
gatgtgtctcgccactttgaggatactagctatggttataaagacttttccaggcatggg
acacatgtgcctactttccatgttcaggactattcatgggaggaccatggctattccctg
gtaaaccgtctctacccagatgttggacagctgattgatgaaaaatttcaaatcgcctat
aacttgacttacaacactatggccatgcataaagatgtggatacctcaatgcttagaaga
gcaatctggaattatatccactgtatgtttggaataagatatgatgattatgattatggt
gaaattaaccagctactggaccgcagctttaaaatttatatcaaaactgtggtatgtgct
cctgagagaaccacaagtagaatgtatgacagcttctggaggcagttcaagcactctgag
aaggttcatgtcaatttgcttcttatagaagcccggatgcaggcagaactgctttatgct
ctgagagccattactcgctacatgacctga

KEGG   Anolis carolinensis (green anole): 100565147
Entry
100565147         CDS       T01608                                 

Gene name
sesn2
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100565147 (sesn2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100565147 (sesn2)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 100565147
NCBI-ProteinID: XP_016854229
Ensembl: ENSACAG00000010993
LinkDB
Position
Un
AA seq 461 aa
MPVPFSLFFPQTRGIKIPRQLGRGPSSFIPVEEILQEGAERAQRHLFIEAFLSSGRVDNI
TMVMGLHPEYLTSFWKTQYLLLRMDGPLPYHKRHYIAIMAAARHQCSYLVGFHMGEFLHM
GGDPEWLRGLQFAPQKLRNLNEINKILAHRPWLITKEHIKALLKTGENSWSLAELIQALV
LLTHYHSLASFVFGCGVNLESDPEAPHAGQAPSPLGCDSSSPGSDEGVHAPGGTDAMEEV
EVLMERMKLLQECQLDEEEVTPEEMETCFEREKRESLLVTPADIAEHSLPPNILCFVEDP
EFGYKDFTRRGEQTPPTFRAQDYTWEDHGYSLINRLYPDVGQLLDEKFQVVYNLTYHTIA
MHSGVDTSMLRRAIWNYVHCVFGIRYDDYDYREVNQLLERSLKIYIKTVACYPEKTTKRM
YTHFWRHFKHSEKVHINLLLLEARMQAALLYALRAITRYMT
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgcccgtgcccttctctctcttttttccccagaccagaggaataaaaatccctcggcag
ctgggacgaggcccgagttctttcatcccggtggaagagatcctgcaggaaggagcggag
cgggcccagcggcacctcttcatcgaggcctttctgtcgtccggcagggtggacaacatc
accatggtgatgggccttcatcccgagtacctgaccagcttctggaagacgcagtacctc
ctcctgcggatggacgggcctctgccctaccacaagcgccactacatcgccatcatggct
gcggcgaggcaccagtgctcctacctggtgggcttccacatgggggagttcctgcacatg
gggggggaccccgagtggctgcgcggcttgcagttcgccccacagaagctgaggaacctc
aacgaaatcaacaagatcctggcccaccggccttggctgatcaccaaggaacacattaag
gcgctcctgaaaacgggtgagaacagttggtccctggcagaactcatccaggcgctggtg
ctgctcacccattaccactcgctggcttccttcgtgttcggctgcggcgtcaacctggag
agcgacccggaggccccccacgccggccaggccccctccccactcggctgtgacagcagc
agccccggctccgacgagggggtccacgctcccggcggcaccgatgcgatggaggaggtg
gaggtgctgatggaaaggatgaagctcttgcaggagtgccagctggacgaagaagaggtc
accccggaggaaatggaaacctgctttgagagggaaaagagagagagcctcctggtcact
cccgcagatattgccgaacactccctgcctcccaacatcttgtgcttcgtggaggaccct
gagtttggatacaaggattttactagaagaggagaacaaacgcctccgactttccgagct
caggactacacctgggaagatcacggatattcactcatcaaccgcctctatcccgatgtg
ggtcagttgctcgacgagaagttccaggtggtctacaacctgacctatcacaccatagcc
atgcacagtggggtggacacgtccatgctccggagagccatctggaactacgtccactgc
gtctttgggatccggtacgacgactatgattacagggaggtgaaccagcttttggagcgc
agcttgaaaatctacatcaaaacggtcgcctgctatccagagaaaaccaccaagagaatg
tacacccacttctggaggcatttcaaacattctgagaaggtgcacatcaacctgcttctg
ttggaggcgcgcatgcaagctgccctgctgtatgcgctgcgtgccatcacccgctacatg
acctga

KEGG   Anolis carolinensis (green anole): 103282094
Entry
103282094         CDS       T01608                                 

Definition
(RefSeq) sestrin-3
  KO
K10141  sestrin 1/3
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103282094
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 103282094
NCBI-ProteinID: XP_008122832
Ensembl: ENSACAG00000011219
LinkDB
Position
Un
AA seq 433 aa
MILCPTKQCQRLQAAKMSTGGDTERAPQLLLAKALSGRSRREALTLQMGLHPPYLESFLR
MQHYLLHMDGPLPFDCRHYIAIMAAARHRCRYLVNLHVLQFLRFGGDPLWLRGLDYIPPK
LRKLSEINKILAHRPWLVGKEHIEKLLKTGEQSWSLAELVHAVVLLAHYHALASFAFGCE
TDLCPEGRALMRLGLPGGLCFCDAGHGAGMEGLPLGRKRSLDSCVELESLRDRIHRLQVE
QEEMRLPSDRDEGSDGGISGAADLSCFLQDPGFGYQDFAQCDKDRLQIFRVQDYSWEDHG
FSLVNRLYSDIGLLLDERFRTVDGLKGGSMAKRQGCEHAAFKRAIWNYVHCIFGIRYDDY
DYAEVNHLLERLLKLYIKTVTCFPEKMNPETFERFWKQFKHSEKVHVNLLILEARLQAEL
LYALRAITHHMVS
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgatcctctgcccgacgaaacagtgccagaggctgcaggcggccaagatgagcaccgga
ggggacacggagcgggctccacaactgctcttggcgaaggcgctgtctggccggagccgc
cgggaggccctgaccctacagatgggcctccacccgccctacctggagagtttcctccgg
atgcagcactacctcctccacatggacgggcccctgcccttcgactgccggcactacatc
gctatcatggccgctgcccggcaccgctgccgctacctggtcaacctccacgtcctgcag
ttcctgcgttttgggggtgacccactctggctccggggcctggactacatcccaccaaaa
ctccggaagctcagcgagatcaacaagatcctggcccatcggccctggctggtcggcaag
gagcacatcgagaagctgctgaagaccggagagcagagctggtctctggcggagctggtg
cacgcggtggtgctgctggcccactaccacgctctggccagcttcgccttcggctgcgag
acggacctttgccccgagggacgggccctgatgcggctgggcctgccgggggggctctgc
ttctgcgacgctgggcacggagccggcatggaggggctgccgctcgggcgcaaacggtcc
ttggactcctgtgtggagctagagtccctccgcgaccgcattcaccggctgcaggtggag
caagaggagatgcggctgccctccgaccgggacgaaggctccgacggggggatctccggt
gcagcagacctctcctgcttcctgcaagaccccggcttcggctaccaggactttgcgcag
tgcgacaaagaccggctgcagatcttccgcgtccaggactactcctgggaggaccacggc
ttctcgctggtgaaccggctctactcggacatcgggctcctgctggacgagagattccgg
acggtggacggcctcaagggcggctccatggccaagcgccagggctgcgaacacgccgcc
ttcaagcgtgccatctggaactacgtccactgcatcttcgggatcaggtacgatgactac
gactacgccgaagtcaaccacctcctggagcgcctcctcaagctctacatcaagacggtc
acctgcttccccgaaaagatgaacccggagacgtttgagcgcttctggaagcagttcaag
cacagtgaaaaggtccacgtgaacctgctcatcctggaggcccggctgcaggcggagctg
ctctacgcccttcgggccatcacccaccacatggtctcctag

DBGET integrated database retrieval system