KEGG   Anolis carolinensis (green anole): 100558584Help
Entry
100558584         CDS       T01608                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00590  Arachidonic acid metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100558584 (ptgs1)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100558584 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 100558584
NCBI-ProteinID: XP_008122862
Ensembl: ENSACAG00000012242
UniProt: H9GIV7
LinkDB All DBs
Position
Un
AA seq 601 aa AA seqDB search
MRGSWGTILLGMMMMLLLLLSTKASPGSSEPVNPCCSFPCQNKGVCVRTGVSGYECDCTR
TGYYGTNCTVPEFWTRLHDAVRPSPAFYHFILTHFKWFWDVINNTFIRDTLMRLVLTMRA
NLIPSPPTYNSRYGYLSWESYSNLSYFTRVLPPVPTDCPTPMGTKGPSPLPDPQVVVERL
LLRRTFRPAPQGTNLMFAFFAQHFTHQVFKTSGKMGHGFTRALGHGVDLGHIYGDNLDRQ
HQLRLFRDGMLKYQMVKGEMYPPSVEEAPVHMIYPAHVPPEARLAVGQEVFGLLPGLMMF
ATIWLREHNRVAALLKDEHPAWDDEQLFQTARLILIGETIKIVIEDYVQHLSGYYLQLKF
DPELLFGAQFQYHNRIAVEFNQLYHWHPLMPDTFRVQGQEYSYEQFIYNTSMLTDYGVGA
LVEAFSKQRAGQIGGVPNLHRNLLKVATGAIEESRLLRLQPFNEYRKRFNLKPYTSFQEL
TGDEASASALEELYGDIDAVEFYPGMLVEKAQPRAIFGESMVEIGAPFSLKGLLGNPICS
PEYWKPSTFGGETGFRLVKTTTFRDLVCRNLKAKEEKECPYVAFQVPETALEAEGAERKE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggctcctggggcacaatcctgctggggatgatgatgatgctgctgctgctgctc
agcaccaaggccagcccaggctcctccgaaccagtgaatccctgctgctctttcccatgc
cagaacaaaggcgtgtgcgtccgcaccggcgtgtccggctacgagtgcgattgcacccgg
accggttactacggcaccaactgcactgtgcccgaattctggacgcgcctccatgacgcc
gtgcggccctcgcccgccttctaccacttcatcctgacccatttcaagtggttctgggac
gtcatcaacaacacgttcatccgggataccttgatgaggctggtgctgaccatgcgggcc
aacctcattcccagcccgcccacctacaactccaggtacggctacctcagctgggagtcc
tattccaacctgagctacttcacccgcgtcctgccgccggtgcccaccgactgccccacg
cccatgggcaccaaagggccgtcgccgctcccggacccgcaggtcgtggttgagcgtctc
ctgctccgccggaccttccgaccggccccgcagggcaccaacctgatgttcgccttcttc
gcccagcacttcacccaccaggtcttcaagacctccggcaagatggggcacggcttcacc
agggccctgggacacggggtggacctgggacacatttatggggacaacctggaccggcag
caccagctccggctctttcgggacgggatgctcaagtaccagatggtcaagggggagatg
tacccgccctcggtggaggaggccccggtgcacatgatctacccggcgcacgtcccgccc
gaggcccgcctggcggtggggcaggaggtctttggcctgctcccgggactcatgatgttc
gccaccatctggctgcgcgagcacaaccgggtcgccgccctcctcaaggacgagcacccc
gcctgggacgacgagcagctcttccagaccgccaggctcatcctcattggggagaccatc
aaaatcgtcatcgaggactacgtccagcacctcagcggctactacctgcagctgaagttc
gacccggagctgctctttggggcgcagttccagtaccacaaccgcattgcggtggagttc
aaccagctctaccactggcacccgctcatgccggacaccttccgggtccagggccaggag
tacagctacgagcaattcatttacaacacctccatgctgaccgactacggcgtgggcgcc
ctggtcgaggccttctccaaacaacgggctggccagatcggtggggtgccgaacctccac
agaaacctcctgaaagtagccacgggggccattgaggagtccaggctgctgcgcctccag
cccttcaacgagtaccggaagcggttcaacctgaagccctacacgtccttccaagagctg
acaggggacgaggcgtcggcatctgccttggaggagctgtacggcgacatcgacgcagtg
gagttctacccggggatgctggtggagaaggcgcagccgcgggccatctttggggagagc
atggtggagatcggggcgcccttctccctgaagggcctgctggggaaccccatctgctcc
cccgagtactggaagcccagcaccttcggcggggagaccggcttccggctggtgaagacc
accacgttccgggacctggtctgccgcaacctcaaggccaaggaggagaaggagtgtccc
tacgtggccttccaggtccccgagacggccctcgaggcggagggcgcggagaggaaggag
ctgtag

DBGET integrated database retrieval system