KEGG   Anolis carolinensis (green anole): 100561578
Entry
100561578         CDS       T01608                                 

Gene name
adgrb1, bai1
Definition
(RefSeq) adhesion G protein-coupled receptor B1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100561578 (adgrb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100561578 (adgrb1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acs04131]
    100561578 (adgrb1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:acs04030]
    100561578 (adgrb1)
Peptidases and inhibitors [BR:acs01002]
 Mixed peptidases
  Family P2
   100561578 (adgrb1)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Phagocytosis
   Others
    100561578 (adgrb1)
G protein-coupled receptors [BR:acs04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   100561578 (adgrb1)
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS TSP1_CCN
Other DBs
NCBI-GeneID: 100561578
NCBI-ProteinID: XP_016850912
LinkDB
Position
Un
AA seq 1641 aa
MRRSAGYSLNLLLLLPLFFAWTAVALDLGQSSCTTLVQGKFFGYFSSFAVFPLNTSHCSW
IIQNPDPRRYTLYMKVLKPAGVCDHQLIRTYQFDSFLESTRTYLGMESFDDVLNLCDSST
RYAFLQSNKQFLQMKQMGSPLESGPVRWKPYKVQERDFSVEYLVVGNRSPSKAACQMLCK
WLDTCLTTSSSSHPCGIMQTPCSCSSGEALDQPSEILGITKKKDGCFKGGIYLENCLSSP
KDSSGQDLLGGWNPWSMWGECTRDCGGGLQTRTRTCQPLPEDGLICEGVLEEGRLCNRKA
CNPNGHYNSRSQSLRSTDNRKRDDMDEFQQYGYPAPQIGDPAAEEWSPWSVCSTTCGEGW
QTRTRFCVSYSYSTQCSGPLREQRQCNNSAVCPVHGAWDEWSPWSLCSSTCGRGYRDRTR
TCKPPQFGGNPCEGPEKQTKFCNIALCPGHSVDGNWNEWSSWSSCSTSCSNGTQQRTREC
NGPSYGGAECQGHWVETRDCFLRQCPVDGKWQVWGPWGSCTATCGGGTQKRDRSCYGPFF
GGSVCQGTREEFKQCNEKRCPEPHEICDEDSFASVIWKETPAGDAAAVRCPRNATGLILR
RCLLDEEGIAYWTIPTYVKCVSIDYRNIQMMTREHLSKAQRGLIGDGISEVLQNLVEISQ
DGTSYSGDLLSTFDVLRNMTEIFRRAYYSPNPSDVQNFVQVISNILTEDNRDKWEEAQLM
GPNAKELFRLVEDFIDVIGFRMKDFQDSYQVTENLVLSIQKLPANAAKDISFPMKGWRGM
VDWARTAEDKVTVSKSILSTGVSETDDSAVFVVGTVLYRNLGGILALQRNTTVLNSRVLS
VTVKPAPRSLLTPMEIEFSHLYNGTTNQTCILWDEADVYHTWGEWAMCVLGRELVGIVLC
LFPGNLLVMLVFFSPSVSLCSLCTVIPPPPSFHRPSSSTTITSSSSSSFSSSQLGAWSWR
GCRTVPVDPFRTKCLCDRISTFAILAQLSAEMNSEKVLVPSVTLIVGCGVSSLTLLLLII
IYISVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFLSSFC
WVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSL
EGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLA
LTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGN
GDSGGSFQNGHAQLMTDFEKDVDMACRSGEHITVLNKDIGTCRTMTITGTLKRPSLQDEE
KLKLNQQKGSSNFNSLPANVSKMHLQGSPHYLGAINLNDFSNHTLTLKKDKSQPPKSIYI
CDGDIFKKLDSELSRAQDQAIDTSYVILPSNTSTLRPKPPPPPPPPKDDTKYSINIDQMP
QTRLIHLSMATDPGFVVKSPPREPVGMSCGEIQASPLMQQQQHQLSPPLVNKSGDSKMPN
SLCDTGESGHPGMMPKGENIATLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRK
LQHAEKDKESPTIDSKQEKQQTPNKRPWEGIRKVHSPPAWVKKDMEPISPSPLELKTVEW
EKAGATIPLVGQDIIDLQTEV
NT seq 4926 nt   +upstreamnt  +downstreamnt
atgaggagaagcgctggatattccttgaacctgcttttgttattgccacttttctttgcg
tggacggcagtggccctggacttggggcaatcttcatgcacgacattggtccagggcaaa
ttctttgggtatttctcctcgtttgctgtcttcccgttgaacacttctcattgctcttgg
attatccagaatcctgacccaaggaggtatactttgtacatgaaggtcttgaagcccgcc
ggggtgtgtgaccaccagctcatacgcacataccagtttgactcgttcttggagtcaaca
cggacgtacctgggcatggagagcttcgatgatgtgctgaacctttgcgacagctccacc
cgctatgccttcctccagtccaacaagcaattcctccagatgaagcagatggggtccccc
ttagaaagtggtcctgtccggtggaagccctacaaagttcaggagagagatttctctgtg
gaatacctggtggtgggcaaccggagtccaagcaaagctgcctgccagatgctgtgcaaa
tggctggatacttgtttgaccaccagcagcagctcccacccatgtggcatcatgcaaacg
ccatgttcctgctccagcggggaggcattggatcagcccagcgagatccttgggataacc
aaaaagaaggacggttgtttcaagggtgggatttacttggagaactgcttgagcagcccc
aaagacagcagcgggcaggatttactgggtggatggaacccttggtcgatgtggggagaa
tgcaccagggactgtgggggtggcctccagactcgaacccggacctgtcaaccccttccg
gaagatggcctcatctgtgaaggagtcttagaagaagggagactctgcaaccggaaagct
tgtaacccgaacggacattacaattcccggagccaatccctgaggtctaccgacaaccgg
aagcgagacgatatggatgagttccaacagtatgggtaccctgctccacaaataggtgat
ccagctgctgaggagtggtccccctggagcgtgtgttcgaccacctgtggggagggctgg
cagacccggacacgattctgcgtctcgtattcctacagcacacaatgcagtgggcctctt
cgggagcaacggcaatgcaacaactcagctgtctgtccagtacatggggcatgggacgag
tggtcaccatggagcttgtgttcatcaacctgtggacgaggatacagggaccgcacccgg
acctgcaaacctcctcagttcggcggaaacccttgtgagggacctgagaagcaaaccaag
ttctgtaatattgcactttgcccaggccactcagtggacggcaactggaacgagtggtcc
agttggagctcctgttccaccagttgctccaacgggacccagcagcggacgagagagtgc
aacggaccgtcttacgggggagccgagtgccaaggacactgggtggagacacgagactgc
ttccttcgacaatgcccagtggatggaaagtggcaagtctggggtccatgggggagctgc
actgccacgtgtggaggtgggacacagaagcgagatcggtcatgctacggtcctttcttt
ggaggaagcgtgtgtcaaggcaccagagaggagttcaagcaatgcaatgagaaaagatgt
ccagagccccatgagatctgtgatgaagatagctttgcttctgtgatttggaaggagact
cctgctggagatgctgcagctgttcgatgtccccgtaatgccacagggctgatcttgcgg
cggtgtttgctcgatgaagaaggtattgcctactggacaattccaacttatgtcaaatgt
gtttccattgactacaggaacatacagatgatgacaagggagcatctttcaaaagcccag
aggggtctgataggagacgggatatcagaggtcttgcaaaacctggtcgagatatctcag
gatggaaccagctacagtggagatcttctttcaaccttcgatgtcctgaggaacatgact
gagatcttccgcagggcctattatagcccaaaccccagtgatgttcagaactttgtgcaa
gtaattagcaacatactgactgaggacaaccgggacaagtgggaagaggctcaactgatg
ggaccaaatgccaaggaactctttaggctggtggaagacttcattgacgtcattggcttc
cgtatgaaagatttccaggattcctatcaagtgactgaaaatctggtcctcagcatccag
aagctccctgccaatgcagccaaagacattagcttcccgatgaaaggctggcgaggcatg
gtggattgggcccgcacggccgaggacaaggtcacggtgtccaaaagcatcctttccacg
ggggtttcagagacagacgactctgccgtctttgtggtggggacagtcctgtaccgaaat
ctgggtgggatccttgccctccaaaggaacaccacagtgcttaattctagagtcctctcc
gtgacggtgaaaccagctccccgatccctgctcacaccaatggaaattgaattctcccac
ttgtacaatggaacgaccaaccagacgtgtatcctctgggatgaagctgatgtatatcat
acttggggggagtgggccatgtgtgtcttggggagggagctggttggtattgtgctgtgt
ttattccctggcaatttgttggtgatgcttgttttcttctctccctctgtctctctttgc
tctctctgcaccgtaattccccctcctccctcctttcacagaccctcctcctccaccacc
atcacctcctcctcctcctcctccttctcctcgtctcagcttggtgcctggtcctggcgt
ggctgccgaacagtcccggtcgatcctttccgaactaaatgcctctgtgacagaatctct
accttcgccatcttagcccagctcagtgctgaaatgaattcagaaaaagtgctcgttcct
tcggtcaccttaattgttggctgtggggtgtcttccttgacgcttttgctcttgatcatc
atatacatctcagtctggaggtacatccgttcggagcgttcagtcatccttatcaacttc
tgcctttctatcatatcatccaatgctctcattcttattgggcaaacccagacccggaat
aaggtgatatgcaccttggtggcagccttcctgcactttttcttcctctcctccttctgt
tgggttctgacggaggcctggcaatcctatatggctgtcactggccggttacgcaaccgc
atcatccgaaaacgcttcctgtgtcttggatggggcttgcctgccttggtggtggccatc
tctgtgggattcactaaagccaagggatacagcaccatgaactactgttggctctctttg
gaaggcggcctgctgtatgccttcgtgggacctgcagcggctgtcgttttggtgaacatg
gttattggtattctggtgtttaacaaacttgtatccaaagatggaataacagataagaaa
ctgaaggaacgggcaggggcatccctgtggagctcctgcgtggtccttcctctccttgct
ctgacctggatgtcagccgtgctggccatcactgaccgccggtccgcgctcttccagatc
ctctttgcagtctttgactccttggagggctttgtcattgtcatggtccactgcatcctg
agaagagaggtgcaggatgctgtgaaatgtcgagtggtggaccgtcaagaagaagggaat
ggtgattctggaggatcatttcagaacggacatgcccagctcatgactgatttcgagaaa
gacgtggacatggcttgtagatcaggtgagcacataacagtgctcaataaagacatcggc
acctgccgcaccatgaccattacggggactctgaagcgtccttctctgcaggatgaggag
aagctgaagctgaaccagcagaagggttcctcaaactttaacagtcttccagccaacgtc
tccaagatgcacctccaagggtccccacattacctgggggccatcaacctcaacgacttc
agcaatcacaccctgactttgaagaaggacaagagccagcctcccaagtccatctacatc
tgtgatggagatatcttcaaaaagctggactcggagctttcccgggcgcaagaccaagcc
atagacaccagctatgtcatcctgcccagcaacacctccaccttgcggcctaagccacct
ccgccgcctccgccgcccaaggacgatacaaaatacagcatcaacatagaccagatgcct
caaacgaggctcatccacctcagcatggccacagacccaggctttgttgtcaagagcccc
ccaagggaacctgtggggatgagctgtggggagattcaggcttccccgctgatgcagcag
cagcaacaccagttgtcacctcctctggttaacaaatctggtgactcaaaaatgccaaac
agcttgtgtgacacaggcgagtctggtcatcctggaatgatgcccaagggtgagaacatc
gctaccctttccatgagttctcttgagaggcggaaatcccggtatgcagaactagatttt
gagaaaatcatgcacacgagaaaacgtcaccaagacatgtttcaggacttgaaccggaaa
cttcagcatgcagaaaaagataaggaatctccaacaatagatagcaagcaagaaaaacag
cagacgccaaacaagagaccctgggaaggaatccggaaggtccactcgcccccggcgtgg
gttaaaaaggacatggagcctatttccccgtctcctttggaactcaaaactgtcgagtgg
gaaaaggcaggggccaccatccctctggtgggacaggacatcattgacctccagacagaa
gtctga

DBGET integrated database retrieval system