KEGG   Anolis carolinensis (green anole): 100561911
Entry
100561911         CDS       T01608                                 

Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100561911
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100561911
   04217 Necroptosis
    100561911
   04115 p53 signaling pathway
    100561911
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100561911
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100561911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acs03029]
    100561911
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acs02000]
    100561911
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100561911
Transporters [BR:acs02000]
 Other transporters
  Pores ion channels [TC:1]
   100561911
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100561911
NCBI-ProteinID: XP_003226241
Ensembl: ENSACAG00000017500
UniProt: H9GPC1
LinkDB
Position
Un
AA seq 207 aa
MAAAAADPGRSREAGAPPRKAGTSSDQILQTGTVLLKGFIWDRVQSCGDSERIQATLAEL
KESESRICDPKTKQLSECLRRIGDELDGNMELQSMIEQVQVYPPKEVFFRVAAEMFSDGT
FNWGRVVALFYFACKLVLKAICTKLPELIKTIISWTMEYIKNHVLTWIQAQGGWEGLLSY
FGTPTWQTIAVFAAGVLTASLTFWKMS
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggcagcagcagcggatcccgggagatcgcgggaagctggggccccacctcggaaa
gcgggcaccagttcagatcagatccttcagacaggaactgtgcttctgaagggatttatt
tgggaccgagtgcagagctgtggagactctgaacgcatccaggcaacgttggcggagctc
aaggaatcagagtctcggatttgtgaccctaagaccaagcagttgagtgagtgcctgcgc
cggattggagatgaactggacggaaatatggagctgcaaagtatgatagaacaagtccag
gtgtatccgccaaaggaggtttttttcagagtcgctgccgagatgttctctgatgggacc
ttcaattggggacgagtggtagctttgttctactttgcatgcaagttggtcctgaaggca
atttgcactaaattaccagagctcataaagaccatcattagctggacaatggagtacatc
aaaaatcatgtcctgacctggatccaagcccagggaggatgggagggcctcctgtcctac
ttcggcaccccgacttggcaaactattgctgtatttgcggctggtgtcttgactgcctcg
ctcaccttctggaaaatgtcttaa

KEGG   Anolis carolinensis (green anole): 100562834
Entry
100562834         CDS       T01608                                 

Gene name
bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs05132  Salmonella infection
acs05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100562834 (bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100562834 (bax)
   04217 Necroptosis
    100562834 (bax)
   04115 p53 signaling pathway
    100562834 (bax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100562834 (bax)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100562834 (bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acs03029]
    100562834 (bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acs02000]
    100562834 (bax)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100562834 (bax)
Transporters [BR:acs02000]
 Other transporters
  Pores ion channels [TC:1]
   100562834 (bax)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100562834
NCBI-ProteinID: XP_003225279
LinkDB
Position
Un
AA seq 204 aa
MASEQTVPCQTGGPGMSDNIFHILRIGKALLIGFIRQLWQQYRASNPQVPPLEETTREDL
SVEGAEASPDAAAVTSLQDCMFRIWQELSSNRDLTSMVESATGKNPLEVLADVSEHLFAD
GINWGRIVVFFYFAFRVIAQYTPSWFHDVVSWAMTFLQNHLANWIQQQGGWEGLLSYFGT
PTWQTIAVFAAGVLTASLTFWKMS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcatccgaacaaacggtgccctgccaaactggtggtccaggaatgtcagataacatc
tttcacatccttcgaattggaaaagctctcctcatcgggttcataagacagctttggcag
caatatagagcttccaatccccaggtgccccccttggaggaaacaaccagggaggacttg
tcagtggaaggagcagaggcctccccagatgctgctgcagtcacgtctctgcaagattgc
atgttccgtatatggcaggaactcagcagtaatcgtgatttgaccagcatggtagaaagt
gccactggtaaaaaccctctggaagtcctggctgatgtgtctgaacacctgtttgctgac
gggatcaactggggtcggattgttgtctttttctactttgccttccgagttattgcccag
tatacgccaagctggttccatgatgtggtgagttgggccatgaccttcctacagaaccac
ctggctaactggatccaacagcaaggaggctgggagggcctcctgtcctacttcggcacc
ccaacttggcaaaccattgctgtatttgcggctggcgtcttgactgcttcgctgaccttc
tggaaaatgtcttaa

DBGET integrated database retrieval system