KEGG   Anolis carolinensis (green anole): 100563208Help
Entry
100563208         CDS       T01608                                 

Gene name
adprh
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100563208 (adprh)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     100563208 (adprh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 100563208
NCBI-ProteinID: XP_008105901
LinkDB All DBs
Position
3
AA seq 366 aa AA seqDB search
MGLVSSRAIMCSGLLENYMAAMVLSAAGDAMGFCNSKWEFQRDGEKIHNEVAKLGGVSKL
DVANWKVSDDTVMHLATAEALSEAGNDPDLTYLYKLIATNYRDCMDDMCGRSPGGTCMAY
AQNLDPDNPSSWIANFSKQGGGCGAAMRSMCIGLRFRHPEQLETLIAVSIESGRMTHHHP
TGYLGSLAAALFTSYAVNRKPAHEWGRGLMDILPKAKAYIQKSDSFVEENLKHWSYFENQ
WSKYLETRGISDGKSPPSFPEMYGVKERDEFYRSLSYSGWGGSSGHDAPMIAYDAFLGSP
DWTELALRGFFHGGDSDSTAVMAACWWGAMYGYKGVNASNYKNIEYRNRLEKVARELYHL
SLIAEQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggggctggtctcctccagagcgatcatgtgttcaggtttgctagagaactacatggca
gcgatggtgctgagtgcagctggagatgcgatgggcttttgcaatagcaaatgggagttc
caacgggatggtgagaagattcacaatgaggtggccaaactgggtggcgtgagcaaactt
gacgtggccaattggaaagtcagtgatgatactgtcatgcatttggctactgcagaagct
ttgtcagaagctggaaatgacccggatctaacctacctgtataaactcattgcaacaaac
tacagagactgcatggatgacatgtgtggacgatctccaggaggtacctgcatggcatat
gcacagaatctggatccggataacccgtctagttggatagctaactttagcaaacaagga
ggaggatgtggagcagctatgcgctccatgtgcattgggctgaggtttcgtcacccagaa
cagctggaaaccttgattgcagtcagtatagaaagtggtcgaatgactcaccaccacccg
actggatacctcggatcactggcagctgctctcttcacatcttacgctgtaaatcgcaag
ccagcccatgagtgggggagagggctgatggacatattgccaaaagcgaaagcctatatc
cagaagtcagattcctttgtggaggagaacctgaagcattggagttactttgaaaaccag
tggagcaagtacctggaaaccagaggcatttcagatggaaagtcccctccttccttccct
gaaatgtatggtgtgaaagagagggatgagttctataggtccttgagttactctggatgg
ggaggcagcagtgggcacgatgctccaatgattgcttacgatgcctttcttggctctcct
gactggactgagttagcacttaggggctttttccatggaggggacagcgattctactgca
gtcatggctgcctgctggtggggggcaatgtatggctacaaaggggtcaatgcaagcaac
tataagaacattgaataccgaaaccgattggagaaagtagctagagaactctatcacctt
agcttgattgcagaacaatga

DBGET integrated database retrieval system