KEGG   Anolis carolinensis (green anole): 100563783
Entry
100563783         CDS       T01608                                 

Gene name
nr3c1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100563783 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100563783 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:acs03310]
    100563783 (nr3c1)
Transcription factors [BR:acs03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100563783 (nr3c1)
Nuclear receptors [BR:acs03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100563783 (nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100563783
NCBI-ProteinID: XP_003217421
Ensembl: ENSACAG00000013668
UniProt: G1KP59
LinkDB
Position
2
AA seq 773 aa
MEPKEALKSPGEKEAGKSAHFCDKGGIVLDFNPSLRSGTTIKIPASASPLPVSSEPDSIQ
QPVLCDLSKGLGCNVPQPDLSKAVSLSMGLYMGETDTKVMGNELGFPQKGQISLSSGDTD
FRLLEESIASLNKSSSLAEGSKGATSIDTSLESEFPSMAGRDLTLDQGALAQGQVGTNGG
NLKLFSEDQSTFDILQDFDLPPVSPGKETNGSPWRIDPVLDESSLLSPLGGDEGYLLEGN
EMEDCKPPILPDTKPKINESDDFLTSSTMQMPQVKTEKEDFIELCTPGVIKQEKIGTVYC
QANFPGSNMLGNKTSAISVHGVSTSGGQIYHYDLNMASVTQQQDQKPVFNAIPSHPAGSE
NWNKCQGAGDDLSPIGALNFPGRSIFSNGYSSPGIRSDVSSSPSTSSTTAGPPPKLCLVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQA
GMNLEARKTKKKIKGIQQSSMTAGRETAENPGNKAIVPASLPQLTPTLVSLLEVIEPEVM
FSGYDSTIPDTTWRIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLM
AFALGWRSYKQSNGSLLCFAPDLIINEQRMNLPCMYEQCKRLLVVTNELARLQVSYEEYL
CMKTLLLLSTIPKEGLRSQALFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDS
MHDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQLPKYSNGNIKKLLFHQK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggagcccaaagaagcactaaaatccccaggagagaaggaagctggaaaaagtgctcat
ttctgtgacaaaggaggaattgtgctagactttaatccatccttgagaagtggcactact
atcaagattcctgcatctgcatctcccctgcctgtctcttctgagcctgactccatacaa
caacctgttctgtgcgacttgtcaaagggattaggatgcaatgtgccacagccagatctc
tctaaggcagtatcgctatcaatgggattgtacatgggtgaaacagatacgaaggtgatg
ggaaatgaacttggatttcctcagaagggccaaatcagtctgtcttctggagatacagac
tttaggctccttgaagaaagcattgcaagtttgaataagtcttctagcctggcagaaggc
tcaaaaggtgctacatctattgacacaagcttagaatcagagttcccaagcatggctgga
cgtgatcttactttagatcaaggggctttagcacaaggccaggttggcacaaatggtggc
aacttgaagcttttttctgaagaccaaagcacctttgatattttgcaggattttgatttg
ccaccagtgtctccaggaaaagaaacaaatggaagcccttggagaatagaccctgtgctg
gatgaaagtagcttgctttcccctcttggtggagatgagggctatctcctggaaggaaat
gaaatggaggattgcaaacctcccattttacctgacactaagcctaaaattaatgaaagt
gatgattttttgaccagttctacaatgcaaatgcctcaagtaaaaactgagaaggaagat
tttattgaattatgcaccccaggtgtaataaagcaggagaaaattggcacagtttattgt
caagctaatttcccagggtcaaatatgctaggaaataaaacatctgccatttctgttcat
ggtgtcagcacttcaggagggcagatctaccactatgacttgaacatggcatctgtcact
caacagcaggatcagaaaccagttttcaatgccattccatctcatcctgctggttcagaa
aattggaataagtgccagggagctggggatgatctttcaccaataggggcattgaatttt
cctggaaggtctatattctctaatggatattcaagccctggaataagatctgatgtaagt
tcttcaccctctacctcttcaacaactgcgggaccacctcccaagctttgccttgtttgc
tcagacgaggcttctgggtgtcattatggtgtccttacttgtggcagctgcaaagtattc
ttcaaaagagctgtggaagggcagcacaattatctctgtgctggaagaaatgattgtatt
attgacaaaattcggagaaagaactgccctgcttgccggtaccggaaatgtcttcaagct
ggcatgaatctagaagcacgaaagacgaagaaaaaaataaaaggaattcagcaatccagc
atgactgcagggagagagactgctgaaaatcctggaaataaggctatagttcctgcctca
ctgccacagcttactcctaccttggtttccctactggaagtgattgagccagaggtgatg
ttttcaggctatgacagcacaataccagacacaacttggcgtataatgtcaactcttaat
atgctaggaggaagacaagttgtagctgcagtgaaatgggcaaaggcaataccaggtttc
aggaacttgcatttggatgaccaaatgactcttctacagtattcatggatgtttctgatg
gcgtttgctcttggatggagatcatataaacaatccaatggaagtctgctctgttttgcc
ccagatttgatcattaatgagcagagaatgaatttaccttgtatgtatgaacaatgcaaa
cgtttgctggtggtcactaatgagctggcacggcttcaagtttcatatgaagaatacctt
tgcatgaaaaccttgttgcttctctctacaattcccaaggagggcttgagaagtcaggcc
ttgttcgatgaaatacgtatgacctacatcaaagagttgggaaaagccatagtgaagaga
gaagggaactccagccagaactggcaaagattttatcaactgacaaaactcttggattcc
atgcatgatgtggttgagaatcttctaagcttctgcttccaaacgtttttggacaaatcc
atgagtattgagtttccagaaatgttggcagaaatcatcagcaatcagttaccaaaatat
tcgaatgggaatatcaagaaactcttatttcatcagaaatga

DBGET integrated database retrieval system