KEGG   Anolis carolinensis (green anole): 100564178
Entry
100564178         CDS       T01608                                 

Gene name
rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
acs  Anolis carolinensis (green anole)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663 Ras_bdg_2 C1_2 PHD
Other DBs
NCBI-GeneID: 100564178
NCBI-ProteinID: XP_008103252
Ensembl: ENSACAG00000008638
LinkDB
Position
2
AA seq 363 aa
MEMIELRALRPERALDLTEPRPAVRLERANALRISPKGKVPEILSRVRRIQLRGGQRDPR
LTEELGEGHRFRPCAQSQPTWCDLCGEFIWGAYKKTLQCLHCKFICHYRCRALIRLDCSG
PRYQDNDQNEGSEQTVEKDTNVDELVDWEKPILSQAEIEQKIKEYNSQINSNLFMSLNKD
GSYTGFIKVQLKLIRPVSVPSNKKAPSIQDTRKSSSRSQAVKRRTSFYLPKDTVKHLHII
SRTRASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYLRKLSDEEQPLHLRLLAGPSEK
TLSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHVRQILQKYANCRQKMQEAMATC
TPG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagatgattgagctaagggcgctgcggccggagagggccctggacctgacggagccg
cgcccggccgtccgcctggagcgggccaacgcgctgcggatctcgcccaaggggaaggtg
cccgagatcctgagccgcgtccgccgcatccagctccgcggcgggcagcgcgacccccgg
ctgaccgaggagctgggcgaggggcaccgcttccggccctgcgcccagagccagcccacc
tggtgcgacctctgcggggagttcatctggggcgcctacaagaagacgctccagtgcctc
cactgcaagtttatttgtcattatcgatgccgtgctctgatccggcttgactgcagtggc
cccagatatcaagacaatgatcagaatgaaggcagtgaacagactgtggaaaaagatacc
aatgtggatgagctagtcgactgggagaagcctattctttctcaggctgaaattgagcag
aagataaaagaatataatagccaaatcaacagcaacctttttatgagcttgaacaaagat
ggttcctacactggctttatcaaggtgcaattaaagctgatacggcctgtctcagtgcct
tccaacaagaaggcaccctccatccaggacaccagaaagagctcctcccgcagccaagct
gtaaaacgtcgtacctccttctacttacccaaggacacagtcaagcacttacacataatt
tctcgaacacgtgccagcgaagtcattgaggccttgctgaagaaatttatggtagttgac
aaccctcgcaagtttgccctctttgagagaacagagaaagatgatcaagtatatctccgc
aaactttctgatgaagagcagcctctgcatcttcgactgctagctggacctagtgaaaag
acactgagttttgttctgaaggagaacgaaacgggagaagtcaattgggatgccttcagc
atgcctgagctgcagaatttcctgcgtattctgcagcgtgaagaagaggagcatgttcgt
cagatcctgcaaaaatatgccaattgccgccaaaagatgcaagaggccatggccacctgc
acaccaggttga

DBGET integrated database retrieval system