KEGG   Anolis carolinensis (green anole): 100564507
Entry
100564507         CDS       T01608                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100564507 (zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 100564507
NCBI-ProteinID: XP_003218167
Ensembl: ENSACAG00000005005
UniProt: G1KDE8
LinkDB
Position
3
AA seq 292 aa
MILLQQGGPPLPLPPEKLPPLPMSVATRPTANLLLSPQKPHGLGPSLPLTQDEELATGVE
QDPVLEELCKPLCCRLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAANSCPAPTRMSNSLE
PATNPIVSLPPQGTLSKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLA
EAQNNSFSEISEVVGKRRVRKEGNEYKMMQNRRNIYAVQNNTGPYFNPRSRQRIPRDLAM
CVTPSGQFYCSMCNAGASEEAEFRQHLESKQHKSKVSEQRYKNEMENLGYLQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgattctcctgcagcaaggtggacctcctcttcctcttcctcctgagaagctgccgcct
cttcctatgtcagtggccaccaggcccacagccaacttgctactctccccacagaaacca
catggactgggaccatccctgccacttacacaagatgaggaacttgctacaggggtggag
caggacccggtcctggaggaactgtgtaagcctttgtgttgcaggctctgtaacgtcacc
ttgaattctgcacagcaagcccaggctcattaccaggggaaaaaccacagtaagaaactt
aggaattactatgctgccaatagctgccctgctcctaccaggatgagtaactcacttgaa
ccagcaacaaatccaatagtttcccttccaccccaggggactttatcaaagccaggtggg
cgagtgatcttggccacggagaatgactactgtaaactgtgtgatgcctccttcagttca
ccggctgtggcccaggctcactaccaaggaaagaatcatgccaagaggctgcgcctggct
gaagcacagaacaactcattctcggagatatcagaagtagtgggcaaaagaagggttcgg
aaagaagggaatgaatacaagatgatgcagaacagaagaaacatctatgctgtccagaat
aacacaggtccttatttcaacccacgatcccgccagcggattccccgtgacctcgccatg
tgcgtcacccccagcggccagttctactgctccatgtgcaatgccggtgccagcgaggag
gccgagtttcgccaacacttggaaagcaaacagcacaagagcaaagtgtctgagcagcgg
tacaagaacgagatggagaaccttggctatctacaatga

DBGET integrated database retrieval system