KEGG   Anolis carolinensis (green anole): 103280258
Entry
103280258         CDS       T01608                                 

Gene name
pmaip1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04115  p53 signaling pathway
acs04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103280258 (pmaip1)
   04115 p53 signaling pathway
    103280258 (pmaip1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 103280258
NCBI-ProteinID: XP_008116819
LinkDB
Position
Un
AA seq 167 aa
MDWITWGFSSLRLLLRLLLLRPATCPHLPRRTRLLIGRRATRGGGDSSLTSLGNPRHLLC
LGAPGEKRALARREGEKEGRELGQSSRRSLRFFPPPSRTHRRDQSEMMPGKNSRKGAVPA
SASSSSRTESEVAAECALQLRVIGDKWNLRQRILNMISKIFCPGRGE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggattggatcacctggggattttcatctctccgcctcctcctccgcctcctcctcctc
cggccggcaacttgcccccacttgcccaggaggacccggcttctgattgggcggcgggcc
acccgagggggcggggattcctccttgacgtcactgggaaacccccggcacttgctttgc
cttggcgcgcccggcgagaagcgggcacttgcgcggcgggaaggcgagaaggaaggaagg
gagctgggccaaagtagccgaagaagcctacgattttttcctcctccttctcgaacccac
aggcgggaccaaagcgaaatgatgccggggaaaaactcgcgcaaaggcgcggtccctgct
tcggcctcctcctcctcgcggacagaatctgaggtggcggcagaatgcgcattgcaactg
agagtgattggagacaagtggaacctccgacagaggatcctaaacatgatttccaagatc
ttctgcccaggaagaggagagtga

DBGET integrated database retrieval system