KEGG   Actinomadura sp. WMMB499: F7P10_34545Help
Entry
F7P10_34545       CDS       T06213                                 

Definition
(GenBank) protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
actw  Actinomadura sp. WMMB499
Brite
KEGG Orthology (KO) [BR:actw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:actw01001]
    F7P10_34545
Enzymes [BR:actw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     F7P10_34545
Protein kinases [BR:actw01001]
 Serine/threonine kinases: Other
  Bacterial family
   F7P10_34545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase TPR_19 Pkinase_Tyr TPR_16 DZR TPR_14 RIO1 ANAPC3 TPR_4
Motif
Other DBs
NCBI-ProteinID: QFG25502
UniProt: A0A5J6UEN2
LinkDB All DBs
Position
complement(7599969..7602404)
Genome map
AA seq 811 aa AA seqDB search
MAAPSSPSGPSAPDACAQAGCGGTIDGGFCATCGSPPGPSGAGTPGTPNAAGGASAPGGA
GGAGAPGGACDKPGCGGTIDDGFCDVCGEAPSPPSATAATGPSGARSLSLGGSRSGSVGT
GRTGSARTGASRPSTGVGGLGAGLINVPRIEPLNPSAAVLRDPKVAETKRYCGHCDEPVG
RSRGGQPGRTEGFCPKCGTGFAFTPKLAPGDLVGGQYAVLGCLAHGGLGWIYLARDKNVS
DRWVVLKGLLNSGDADAQAAAAAERAFLAEVEHPNIVKIYNFVQHDGDGYIVMEYVGGRS
LKEILLQRRDEGADALPVAQAIAYGLEVLRAFGYLHARGLVYCDFKPDNVIQFEEQLRLI
DLGGVRRLDDPDGAIYGTPGYQAPEIADVGPSVSSDLYTVGRTLAVLSFPFKGYTSRFRE
SLPPRSDVPVLARHESFDRFLRRATHQDPDERFQDAAEMADQLTGVLREVLATEDGRPRP
APSALFGPERFAARAAGDDANASALPPVPPATAAAALPVPLVDAGDPAAGFLAGLTSLEP
RQLEATVAGAPQRTPEVRLTLARVKIELGEYEEAGRLLDESDADQPGDWRVEWFRTVALL
ARGRATEAEPRFDRLYDLLPGEAAPKLALARCREESAPGEAARLYELVWRTDDAYINAAF
GLARVRFASGDRAGAISALDSVPESSIRRTSAQVAAVTTAVRSRPAAELTAADLLAAGQR
LGRLGPDALDVRRRDRLTAEILEAALDWLLIGPGRADEARGAALLGATLSEAPLRRHLEG
AYRRLAKVAPDRDESRRLVDAANAVRPRTFL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaccctccagcccatcgggaccctccgcccccgacgcctgtgcccaggccggc
tgcggcgggacgatcgacggcggcttctgcgccacgtgcgggtcgccgccgggcccgagc
ggcgccgggacgccgggcacgccgaacgccgcgggcggtgcgagcgctccgggcggcgcg
ggcggcgcgggcgctccgggcggcgcgtgcgacaagcccggctgcggcgggacgatcgac
gacggtttctgcgacgtctgcggcgaggccccgtcgcccccgtccgcgaccgcggcgacc
gggccgtccggggctcggtcgctgagcctgggcggcagccggtcgggcagcgtgggcacc
ggacggaccggcagcgcgcgcaccggcgcgtcccggccgtcgaccggcgtcggcgggctg
ggcgcgggcctgatcaacgtgccgcgcatcgagcccctgaacccgtccgccgcggtgctg
cgcgacccgaaggtcgccgagaccaagcggtactgcggccactgcgacgagccggtgggc
cgcagccggggcgggcagcccgggcggaccgaggggttctgcccgaagtgcggcaccggg
ttcgcgttcaccccgaagctggcgcccggcgacctcgtcggcgggcagtacgccgtgctc
ggctgcctcgcgcacggcggtctcggctggatctacctcgccagggacaagaacgtcagc
gaccggtgggtggtgctgaagggcctgctgaacagcggggacgccgacgcccaggccgcg
gcggcggccgagcgggcgttcctcgcggaggtcgagcaccccaacatcgtcaagatctac
aacttcgtgcagcacgacggcgacggctacatcgtcatggagtacgtcggcggccggtcg
ctcaaggagatcctgctgcagcggcgcgacgagggcgcggacgcgctgcccgtcgcgcag
gccatcgcgtacgggctcgaggtgctgcgggcgttcggctacctgcacgcccgcggcctc
gtgtactgcgacttcaagcccgacaacgtcatccagttcgaggagcagctgaggctgatc
gacctcggcggggtgcggcggctggacgatccggacggcgccatctacggcacccccggc
taccaggcgcccgagatcgccgacgtgggcccgtcggtgagttccgacctctacaccgtc
ggccgcaccctggccgtgctgagcttccccttcaagggctacacctcccggttccgggag
agtctcccgccccggtcggacgtgccggtcctggcgcggcacgagtcgttcgaccgcttc
ctccgccgcgcgacgcaccaggacccggacgaacgcttccaggacgcggcggagatggcc
gaccagctcaccggcgtcctgcgggaggtgctggccaccgaggacggccggccgcgcccc
gcgccgtcggcgctgttcggccccgagcggttcgcggcacgggccgcgggcgacgacgcg
aacgcctcggcgctgccgcccgtcccgcccgctacggccgccgcggcgctgcccgtcccg
ctggtggacgccggggaccccgccgcggggttcctcgcgggcctcacctcgctggagccc
cggcagctcgaagcgaccgtggccggtgcgccgcagcggacgccggaggtgcggctgacc
ctcgcccgggtcaagatcgagctgggcgagtacgaggaggccgggcggctgctggacgag
tccgacgccgaccagccgggcgactggcgggtcgagtggttccggaccgtcgcgctgctc
gcccgcggccgggccaccgaggccgagccgcgcttcgaccggctgtacgacctgctgccg
ggcgaggccgcgccgaagctggcgctcgcccgctgccgcgaggagagcgctccgggcgag
gccgcgcgcctgtacgagctggtgtggcgcaccgacgacgcgtacatcaacgcggcgttc
gggctcgcccgggtgcggttcgcgagcggcgaccgcgccggtgcgatcagcgcgctggac
tcggtgcccgagtcgtcgatccggcgcacttccgcgcaggtcgcggcggtcacgaccgcg
gtgcgctcgcggcccgcggccgagctgacggcggcggacctgctcgccgccgggcaacgg
ctcggccggctcggcccggacgccctggacgtccggcggcgcgaccggctcaccgccgag
atcctggaggcggcgctcgactggctgctcatcgggccgggccgggccgacgaggcgcgc
ggcgcggcgctgctcggcgcgacgctgagcgaggcgccgctgcgccgccatctggagggc
gcctaccggcggctggcgaaggtcgcaccggaccgggacgagtcccggcggctcgtcgac
gccgccaacgccgtccgtccgaggacctttctgtga

DBGET integrated database retrieval system