KEGG   Athene cunicularia (burrowing owl): 113476078Help
Entry
113476078         CDS       T05777                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00020  Citrate cycle (TCA cycle)
acun00190  Oxidative phosphorylation
acun01100  Metabolic pathways
acun01200  Carbon metabolism
Module
acun_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acun_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113476078 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113476078 (SDHA)
Enzymes [BR:acun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113476078 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 113476078
NCBI-ProteinID: XP_026697203
LinkDB All DBs
Position
2
AA seq 761 aa AA seqDB search
MYFCGCVSQRETGQLGLGAPASRPSPQPRRGSVPGPVLARSSPPSGARRPVVARTRCLPC
DLAGGAPVPGRGAAAGLRARGSRGRAGPSALSADSDPPVLFSEDGRDCCSAPGTGYGEWP
VACQTLARNLHFTVYGKKNASTKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEA
GFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMT
EQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHT
LYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTY
FSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQG
ERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGI
SETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAAS
ASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFAD
GTVRTSEVRLNMQKTMQNHAAVFRTGSVLQEGCEKLKQIYSDLAHLKTFDRGIVWNTDLV
ETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPLQGQQRKPFEEHWR
KHTLSYVDVPSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtatttctgtgggtgtgtttcacagagggagacgggtcagctgggcctgggggccccg
gcctcccgcccctcccctcagccgcggcgtggaagcgtgcctggccccgtactggcccgc
tcttccccgccctctggtgcacgccgaccggtggtggcccgtacccgttgtctcccctgt
gaccttgctggaggagcaccagtcccggggcggggagctgcggctgggctgcgggcgcgg
ggcagccggggtcgtgcggggccgagcgccctctcggcagactcagaccctccggttctt
ttttcggaagatggccgtgattgctgctcggctcctgggacaggttacggggagtggccg
gtggcatgccagactcttgcacgcaacttacacttcacagtctacggaaagaaaaatgct
tctacgaaggtttctgattcgatttcgacacagtatccagtagtggaccatgaattcgat
gcagttgttgtaggtgcaggaggagcaggtctgcgggctgcatttggtttgtcagaggct
ggatttaatacagcatgtgttacaaagctctttcccaccagatctcatactgttgctgca
cagggagggatcaatgctgctctggggaacatggaggacgataactggaggtggcatttc
tatgacacagtgaaagggtctgattggctgggtgaccaggatgccatacactacatgacc
gagcaagccccggctgctgtgatagagttggaaaattatgggatgccgttcagcagaact
gaagaaggaaaaatctatcaacgtgcatttggtgggcagagtcttcagtttggaaaagga
ggacaggctcacagatgctgttgtgttgcagacaggacaggacactcactgttacatact
ctgtatggcaggtctctaagatatgatacgagctactttgttgaatattttgccttggac
ctacttatggaaaatggagaatgtcgtggtgttattgccctttgcatagaggatggcacg
atacatcgttttagagcaaagaacactgtcattgccactggggggtatggccgcacttac
ttcagttgtacatctgctcatactagtacgggtgatggcactgcaatggtcacacgagct
ggacttccttgccaggacttagaatttgtgcagtttcaccctacaggtatctatggtgct
ggctgccttataacagaaggatgtcgtggagagggaggtattctaattaacagtcaaggt
gaaagattcatggagagatatgcacctgttgctaaggatctggcttccagggatgtagtg
tcacgttctatgaccatagaaattcgtgaaggaaggggttgtggtcctgaaaaagaccat
gtgtacttgcagttgcaccacttaccaccacagcagctagcaacccgtctcccagggatt
tcggaaacagctatgatatttgctggagtcgatgtcactaaagagcctattcctgttctg
cctactgtgcattataatatgggaggtattcctactaactacaaaggacaggtgatcaca
catgtgaatggtgaggataaagtggtccctggtttatatgcttgtggggaagcagcttct
gcatccgtccatggtgcaaatcgacttggagcaaactcgcttctggatttggtggtcttt
ggtcgtgcttgtgcccttactattgcagagacatgcaaaccaggagagccagttccctcc
attaaaccaaatgctggtgaagagtcagttgctaatcttgacaaattaagatttgctgac
ggaactgtaagaacttcagaagtgcgacttaatatgcagaagacaatgcaaaaccatgct
gctgtatttcgtactggttctgtactccaagaaggctgtgaaaaacttaaacagatttat
agtgatctggctcatctaaagacttttgacagaggcattgtgtggaacactgacttggtg
gagaccctcgaactgcaaaacctgatgctttgtgctctgcaaaccatttatggtgctgag
gctcgcaaagagtcccgaggtgctcatgccagagaagactataagttacggatcgatgag
tttgactattctaagccactccaaggccaacagcgaaagccatttgaagagcactggaga
aagcacaccctttcatatgtggatgtcccatctgggaaggttaccttgaaatacagacct
gtgatcgacagaactttgaatgaagaagactgctcatctgtcccgcccgctattcgctca
tactag

DBGET integrated database retrieval system