KEGG   Athene cunicularia (burrowing owl): 113487234
Entry
113487234         CDS       T05777                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00220  Arginine biosynthesis
acun00330  Arginine and proline metabolism
acun01100  Metabolic pathways
acun04020  Calcium signaling pathway
acun04146  Peroxisome
acun04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113487234 (NOS2)
   00330 Arginine and proline metabolism
    113487234 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113487234 (NOS2)
   04020 Calcium signaling pathway
    113487234 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113487234 (NOS2)
Enzymes [BR:acun01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     113487234 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400 zf-CCCH_7
Other DBs
NCBI-GeneID: 113487234
NCBI-ProteinID: XP_026717500
LinkDB
Position
19
AA seq 1158 aa
MLCAWQFAFRPRAAKNQSPEEKDINNNVEKNREIHGFEKDDAVFYELSKQQVEMPPIVTS
AKAGDGRENPPQNGIKASNQVSRCPRHMKIRNLANGSSFLDTLHLTAKEVINCRTKACQG
SLMTPKGLVRGTRDGPVPPAELLPQAIDFIKQYYSSFKEPKIEEHLVRLETVTKEIETTG
TYHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFDHICRHIQYATNN
GNIRSAITLFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSVLGDPASVEFTQLCIELGWKP
KYGRFDVVPLVLQANGQDPEIFEFPPEIVLEVPMEHPKYGWFKELDLKWYALPAVANMLL
EVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNNPSSLWKDRAVVE
INVAVLYSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPKKKEIKFSILAKAVLFASSLMRQTRAARP
KVTVIYATETGKSETLANGLHSLFNCAFDTKILCMDEYNICDLEKETILLVVTSTFGNGD
SPNNGKTLKNSLLTLKLLRKKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASPLTPVG
EGDELNGQEEAFRTWAVSTFKTACDIFNIRGKNSIQLPEMYTSDDSWDPKNYRIVRDSQT
MDVAKALAKVHAKDIIPMKLKFRQNLQSLKSSRVTILAKLSCETNQEVHYLPGEHIGIFP
GNQPDLVRGLIAHVRDAPPADQTIRLETCADGGYWTSDKKIPACTLPEALTYLLDITTPP
SQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLL
TQLPLLKPRYYSVSSSCDMTPGEIHLTVAVVNYRTRDGQGPLHHGVCSTWLNTIALNEIV
PCFIRSANEFQLPKEPAKPCILIGPGTGIAPFRSFWQQRLYDLEKRGVRGGDMTLLFGCR
QPDLDHIYKEETEEMKRKGVLKEVYTAYSRQPGQAKVYVQDILQSKLETEVCNLLHKEEG
HVYVCGDVHMAKDVAQTLKGILASHLSLSEQQAEEYFFRLKSQKRYHEDIFGAAFPHEVK
RGVRALQPTSPRTNQPMF
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgttgtgcgcgtggcagttcgccttcagacctcgtgctgctaagaaccagtcccctgaa
gagaaggatatcaataataacgtggagaaaaacagggagatccatggctttgaaaaggac
gatgccgtattctacgagctgagcaagcagcaggtggagatgccgcccatcgtaacttca
gccaaggccggcgacggcagagagaaccctccccaaaacggtatcaaagcttcaaaccaa
gtatccagatgtccaagacacatgaaaataagaaacttggcaaatggatccagctttctc
gacacgctacacttgacagcaaaggaggttatcaactgccggaccaaagcctgccaaggg
tcactcatgaccccgaagggcctggtgagaggtactagagatgggccagttccacctgca
gagcttttacctcaggccatagattttatcaagcagtactacagctcatttaaagagcca
aaaatagaagaacacctggtccgactggaaaccgtgaccaaggagatagaaacaacagga
acctaccatctgacaaaggatgagctgatctttgctgccaaacaggcctggaggaacgcg
ccgaggtgtattgggaggatccagtggtccaatctacaggtgttcgatgcacgtgattgt
aaaacagcaaaggagatgtttgaccatatctgtcgtcacattcagtatgccacaaacaat
ggaaatataaggtcagccatcactctcttcccccagcggacggacgggaagcacgatttc
cgtgtttggaacagccagctcatccgatacgccggttaccaaatgccagatgggtctgtc
ttgggagaccctgccagcgtggagttcacacagttgtgcattgagcttgggtggaagccg
aaatatggccgctttgatgtagttccactcgttctccaagcaaacggccaagacccagaa
atatttgaattccctccagaaattgtcctcgaagtgccaatggagcatccaaagtacgga
tggtttaaggagttggatctgaagtggtacgcgctgcctgccgtggccaacatgctgctt
gaggtgggaggcctggagttccctgggtgtcccttcaacggctggtacatgggcacggag
atcggagtgcgagacttctgtgacgtgcagcgatacaatatcctgaaggaggtagggaga
agaatgggactggagacaaacaacccgtcatcgttatggaaagatcgagctgttgtagag
ataaacgtggccgtgctttacagcttccaaaaacaaaatgtgactatcatggatcaccac
tccgctgccgagtccttcatgaaatacatgcagaacgagtaccgcgtgcgagggggctgc
cccgccgactgggtgtggatcgtgccgcccatgtccgggagcataactccggtcttccac
caggagatgctgaactatgtcctcactcccttctattactaccaggtggatgcatggaaa
acacatgtctggcatgatgagacccggaggccaaagaaaaaagaaataaagttcagcatc
ctggcaaaggctgtactctttgcatcttcactcatgcgacaaacgagggcagccaggccc
aaggtcactgtaatctacgcgacagagactggcaaatctgaaacgctcgccaacggtctg
cacagcttgttcaactgcgccttcgacactaagattctgtgcatggatgagtacaacatt
tgtgacctggaaaaagaaacaatccttttagtggttacgagcacttttggaaatggagat
tccccaaataatggaaagaccttgaagaactccttgctcaccctgaaattgctgagaaaa
aaaattagatacgctgtgtttggtttggggtccagcatgtatccggagttctgtgccttt
gctcatgccattgaccagaaactggcccaactaggggcttctccgctcactccagtaggt
gaaggggatgaactcaacgggcaggaggaagcctttcgcacgtgggcagtcagcacattc
aagactgcctgtgacatttttaacatccgtgggaaaaacagtattcagttgcccgagatg
tatacctctgatgacagctgggatcctaagaactacaggatagtgcgtgactctcaaacc
atggacgtggctaaagcccttgcaaaagttcacgccaaggatataattcccatgaagctg
aaattcagacagaaccttcaaagtttaaaatccagtcgtgttaccatcctagctaagctt
tcctgtgagaccaatcaggaagtgcactacctgcccggagaacatatcgggattttccca
ggcaaccagccagatctagtccgtggcctcatcgcacacgtcagggatgctcctcccgct
gatcagactatcagacttgaaacctgcgccgatggtggctactggacaagtgacaaaaag
atcccagcttgcacgctccctgaggctttgacatacttgcttgatatcactactccaccc
tcccagcaactgctaaaaaaactctcccagctggtaacagcggaaggagacaaacagaga
ctggaagttttgtgccagagcacagaagagtacaataaatggaagttttacaacagccca
aacatcctggaggtcctggaggagttcccttctgctgaggtctccacagctttcttactg
actcagctgccgctgctgaagcccaggtactactctgtcagctcctcctgtgacatgaca
cccggagagattcatctgacagttgcagttgtaaactacaggacgagagacggacaaggg
cctttgcaccacggagtctgcagcacgtggctgaacacaatagctctcaatgaaatagtt
ccgtgttttatacgcagtgctaatgaattccagctcccaaaggagccggccaagccctgc
attctgatcggcccaggaacaggaattgctcccttcagaagtttctggcagcagcgtctc
tatgacctggaaaagagaggtgtcagaggtggtgacatgacactgctgttcggctgccgg
cagccagacctggatcacatctacaaagaagagactgaggaaatgaagaggaaaggagtt
ctgaaagaggtctacacagcctactccaggcaacctggccaagctaaagtctacgttcaa
gacattcttcagagcaagctggagaccgaagtgtgcaacctcttgcataaggaggaaggg
catgtgtacgtctgtggggacgtacacatggccaaggacgttgcccagactttgaagggg
atccttgcaagccacctgagcctcagtgagcagcaggcagaggagtatttcttccggcta
aagagccagaagcgataccatgaagatatcttcggggctgcattcccgcatgaagtcaaa
agaggtgtaagagctttgcaacccaccagtccgagaacaaatcaacctatgttttag

DBGET integrated database retrieval system