KEGG   Azotobacter chroococcum: Achr_b20
Entry
Achr_b20          CDS       T03640                                 

Name
(GenBank) RelE/StbE family addiction module toxin
  KO
K19157  mRNA interferase YafQ [EC:3.1.-.-]
Organism
acx  Azotobacter chroococcum
Brite
KEGG Orthology (KO) [BR:acx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:acx02048]
    Achr_b20
Enzymes [BR:acx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Achr_b20
Prokaryotic defense system [BR:acx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    Achr_b20
SSDB
Motif
Pfam: YafQ_toxin ParE_toxin
Other DBs
NCBI-ProteinID: AJE23476
UniProt: A0A0C4WRX7
LinkDB
Position
pAcX50b:2449..2742
AA seq 97 aa
MPRTADYSKAFLKDWERLSRSGRFDLKRLKEAMLLLVANDGPLGPEWLDHPLKGNWDGYR
ECHIGGDFLLIYRLATGSKLEQIVFVRAGTHANLFEE
NT seq 294 nt   +upstreamnt  +downstreamnt
ttgccgcgcaccgccgattactccaaagcctttttgaaagattgggagcgtctctcccgc
tcaggccgcttcgacttgaagaggctcaaggaggcgatgctgttgctggtggccaatgac
ggccccttggggcccgaatggttggatcatccgctgaaaggaaactgggacggctatcgg
gaatgccacatcggaggcgacttcctgctgatttaccgactggccaccggcagtaagttg
gagcagatcgtgtttgtccgagccggaacccatgccaatttattcgaggagtag

DBGET integrated database retrieval system