KEGG   Azotobacter chroococcum: Achr_b30
Entry
Achr_b30          CDS       T03640                                 

Name
(GenBank) Hypothetical protein
Organism
acx  Azotobacter chroococcum
SSDB
Motif
Pfam: NuA4
Other DBs
NCBI-ProteinID: AJE23477
UniProt: A0A0C4WWX9
LinkDB
Position
pAcX50b:complement(2841..3476)
AA seq 211 aa
MREFDDFNNFYSEAVSLMLSSAQVESFVEQNNSYTFNNLTSDIQVLNEASHFIRIYYAYA
SLDLDRCKTAIDVARLELEILKFEESLLSAYKYGEIAKYFDEVKRGDHLTTVCKLLRKKV
EIVRKALELDEKIASETYTRRTTIIFGIIASATLSPELMQPFAKFYGVNFADEQVGKLVG
IGASVVVVVSLLASTHYMFRFFNWITRKIKI
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcgagaatttgatgacttcaataatttctattctgaggcggtatccctaatgctgtca
tctgcacaggtagaatcttttgtcgagcagaataactcttacactttcaataatcttacc
tcagatattcaggtgttgaatgaggcgtcgcattttatacgaatatactatgcatacgcc
tcgctagatctcgatagatgcaagacagcaattgatgtagcccggctagagctggagata
ctgaaatttgaagaatcactcctatccgcatacaagtacggagagatagctaaatacttt
gatgaggtcaagcgcggcgaccatttaaccaccgtctgcaagctccttcgtaagaaagtt
gagatagttcgcaaggcccttgagctagatgaaaaaattgcgtcagagacttatacacgc
cgaaccaccatcatcttcggaattattgcgtccgctacactatcaccagaactgatgcag
ccgttcgctaaattctatggggtcaacttcgccgacgagcaagtcggcaagctagtcggg
ataggtgcatcggtagtagtagtggttagccttttggcgtctactcactatatgttccga
ttctttaattggattactcgaaagataaaaatataa

DBGET integrated database retrieval system