KEGG   Aeromonas dhakensis: CK627_15890Help
Entry
CK627_15890       CDS       T05186                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
adh  Aeromonas dhakensis
Pathway
adh00473  D-Alanine metabolism
adh00550  Peptidoglycan biosynthesis
adh01100  Metabolic pathways
adh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK627_15890
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CK627_15890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CK627_15890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:adh01011]
    CK627_15890
Enzymes [BR:adh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CK627_15890
Peptidoglycan biosynthesis and degradation proteins [BR:adh01011]
 Precursor biosynthesis
  Amino acid ligase
   CK627_15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASX12150
UniProt: K1JF92
LinkDB All DBs
Position
complement(3410628..3411617)
Genome map
AA seq 329 aa AA seqDB search
MKNIHVLLLCGGGGSEHEVSLRSANFLEKQLSLLPGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKVCFNKITTK
LWLTALGIPNTPYLFLTEQGEASLTEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALRAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHSFAHYLEQILRKAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatccatgtcttgctgctgtgtggcggcggtggctccgaacacgaagtttcg
ctgcgcagtgccaatttcctcgaaaaacagctctctctcctgcccggcgtggaagtgacc
cgggtcgagatgtttgccgaccgctggctcagcgccgatggccgcgagtgcaagctgggg
ctggacaagctgctctctttcgacagcgtggcccgtccggtggattacgtggtgccctgc
atccacggctacccgggtgagaccggcgatctgcaatccttcctcgagctggccggcctg
ccttacctgggctgcgacgccgaggcgagcaaggtgtgcttcaacaagatcaccaccaag
ctgtggctcaccgccctcggcatccccaacaccccttatctgttcctgaccgagcagggt
gaggcgagcctgaccgaagcgaaagcggcgctggcaaagtggggcaaggtcttcatcaag
gcggcctcccagggctcttccgtcggctgctactccgccagcaacgaagcggatctggtg
aagggcattgccgatgccttcggttactccgagcaggtactgatcgaaaaagcggtcaag
ccgcgcgagctggaagtggcggtctaccagtacggcgacgagctggtggctacctacccg
ggtgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agccacaccgagaccgcgctgcgcgccgaggggctgacccaggcccaggccgatgccatc
cacgagtacgccctcaaggcgttccgtcagctcaaactgactcacctctcgcgcatcgac
ttcttcctgaccgaagagggcgagatcctgctgaacgaaatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggccacagcttcgcgcactat
ctggagcagatcctgcgcaaggcggtctga

DBGET integrated database retrieval system