KEGG   Alcanivorax dieselolei: B5T_00427
Entry
B5T_00427         CDS       T02259                                 

Definition
(GenBank) N-acetyltransferase family
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
adi  Alcanivorax dieselolei
Pathway
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    B5T_00427
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B5T_00427
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     B5T_00427
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-ProteinID: AFT68712
UniProt: K0CAM9
LinkDB
Position
439062..439889
AA seq 275 aa
MTNRVDLNAYLERIDYRGPRTAGLSLLAELQRRHIATIPFENLSPFLGLEVALSPQGLER
KLIHQHRGGYCYEHNLLFKNILEQLGFQVSGLGARVLWEQPYTARPAVSHMLLRVTLDEV
DYLVDTGFGALTPTAPLRLDRVGPQETAHEPYRVLHLNDHFLLEAYAGNGWKTLYRFDLR
ELWQADYEMASWYLSHHPRSHFVTNLVACRADADGRRNLNNQRLSIYPPGGERQRRTLSS
VAEVLAVLEQEIGLRLPDHPALEQRVAGLLTAGAG
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaccaatcgggtggatctcaatgcctatctggagcgaatcgattatcgtggcccgcgc
acggcgggactgtcgctgctggcggagctgcaacggcggcacatcgccaccatccccttc
gagaatttgtcaccgtttctcggcctggaggtggcgctgtccccgcaggggctggagcgc
aagctgatccatcagcaccgtggtggctattgctatgagcacaacctgctgttcaagaac
atcctggaacagttgggattccaggtcagcggcctgggggcccgggtgctgtgggagcag
ccctacacggcacggccggcggtgtcccatatgctgctgcgggtcaccctggacgaggtg
gattatctggtggacaccggattcggcgccttgacccccaccgcccccctgcgcctggac
cgtgtagggccgcaggagactgcccatgagccctatcgcgtgctgcacctgaatgatcat
ttcctgctcgaggcttacgcggggaatggctggaaaacattgtatcggttcgatttgcgt
gagctgtggcaggcggactacgaaatggccagctggtatctgtcgcaccatccgcggtcc
catttcgtcaccaacctggtggcttgccgggcggacgccgatggccgccggaacctgaat
aaccagcgcctgtcgatctacccgccgggaggggaacgccagcggcggacgctgagcagc
gtggcggaagtactggcggtgctggaacaggaaatcggtctgcggctcccggatcacccg
gcgttggagcagcgcgtggcgggcttgctgaccgccggggcgggctga

DBGET integrated database retrieval system