KEGG   Alicycliphilus denitrificans K601: Alide2_0166Help
Entry
Alide2_0166       CDS       T01463                                 

Definition
(GenBank) o-succinylbenzoate--CoA ligase
  KO
K18661  malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
adk  Alicycliphilus denitrificans K601
Pathway
adk00280  Valine, leucine and isoleucine degradation
adk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alide2_0166
Enzymes [BR:adk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Alide2_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AEB82604
UniProt: F4GDM1
LinkDB All DBs
Position
184530..186038
Genome map
AA seq 502 aa AA seqDB search
MAQRIHQLLDRWLAEAPGQPFIHLPDGRSLSFADLGALTDAAEAELRALGVRAGDRVLVV
AENCPEHAALILACSRVGAWSCGVNARMAPGEVDAFAAKADARVLYFTASSSRSAAAHAA
RHAAVASVLPGMQHGAARDEATVEPPPLQDDVAALIFTSGTTGAPKGVMVTHEALIHFAR
VSAASRGLGPQDRCYAFVPMTHIFGLATVLLTSLHAGAQLVLRPQFDPEDLLDALAHHGV
TQLQGPPALFSRLLAHLRERSIAHPEAPLLRYVYTGAGPLDLTLKQRVEAAFGQALHHGY
GLSEYAGSVHLTRLSEQRPDTSVGYVVQDAEVQVTDPASGRPVPTGERGELWIRGRGLMR
GYFRDPQATNAVMRDGGWYASGDLGELHADGALFVVGRLKEMIIRSGFNVYPAEVELALN
QLPGVQRSAVVGRPEKDGNEEVIAFVELSAGATFDEAAARARLREQLAPYKQPSHIVTVA
ELPTSHNGKVLKRRLQEQAAKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgcatccaccaactgctggaccgctggctggccgaggcgcccggccagccc
ttcatccacctgcctgacggccgcagcctgagcttcgccgacctgggcgcgctcaccgac
gcggccgaggccgagctgcgcgccctgggcgtgcgcgccggcgaccgcgtgctcgtcgtg
gccgagaactgtcccgagcacgcagcgctgatcctggcctgcagccgcgtgggcgcgtgg
tcctgcggcgtgaacgcgcgcatggcgccgggcgaggtcgatgccttcgccgccaaggcc
gatgcgcgcgtgctgtacttcaccgccagcagttccaggagcgccgccgcccatgccgcg
cgccatgcggccgtcgccagcgtgctgcccggcatgcagcatggcgccgcgcgggacgag
gcgaccgtggagccgccgccgctgcaggacgacgtggcggcgctgatcttcacctcgggc
accacgggcgcgcccaagggcgtgatggtgacgcacgaggcgctgatccacttcgcgcgc
gtgtcggcggcgtcgcgcggcctgggcccgcaggaccgctgctacgccttcgtgcccatg
acgcacatcttcggcctggccacggtgctgctgacctctctgcacgcgggcgcgcagctg
gtgctgcgcccgcagttcgatccagaggatctgctcgacgcgctggcgcaccacggcgtg
acgcagctgcaggggccgccggcgcttttttcgcgcctgctggcccatctgcgggagaga
agcatcgcccaccccgaggcgccgctgctccgctatgtctataccggcgctggcccgctg
gacctgacgctcaagcaacgcgtggaggccgccttcggccaggcgctgcaccacggctat
ggcctgtcggagtacgcgggctcggtgcacctcacgcgcctctccgagcagcgccccgac
accagcgtgggctacgtggtgcaggacgccgaggtgcaggtcaccgacccggccagcggc
cggcccgtgcccacgggcgagcgcggcgagctgtggatacgcggccgcggcctgatgcgc
ggctatttccgcgacccgcaggccacgaacgccgtgatgcgcgacggcggctggtacgcc
agcggcgacctgggcgagctgcatgccgatggcgcgctgttcgtcgtcgggcgcctcaag
gagatgatcatccgctcgggcttcaacgtctatccggccgaggtcgagctggcgctcaac
cagctgcccggcgtgcagcgcagcgccgtcgtcggccgcccggagaaggacggcaacgag
gaggtcatcgccttcgtcgagctgagcgccggcgccaccttcgacgaggccgccgcgcgc
gcgcggctgcgcgagcagctcgcgccctacaagcagcccagccacatcgtcaccgtggcc
gagctgcccaccagccacaacggcaaggtgctcaagcgccgactgcaagagcaggccgcc
aaactttga

DBGET integrated database retrieval system