KEGG   Alicycliphilus denitrificans BC: Alide_4001Help
Entry
Alide_4001        CDS       T01397                                 

Definition
(GenBank) Domain of unknown function DUF1845
Organism
adn  Alicycliphilus denitrificans BC
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1845
Motif
Other DBs
NCBI-ProteinID: ADV01707
UniProt: E8TUJ5
LinkDB All DBs
Position
4176013..4176807
Genome map
AA seq 264 aa AA seqDB search
MATSNEPLQLNLGSLRSAMSLTLHTHHASRIWHGRAAAEGRPGIVGLNGYIAVMNKMKRG
SEQDDPYSDWWMLRIEDKLDQTRTTLQTLRKQVDQALAGVPAALSLGENLNVQPVKLPLF
VNAQLGFAAVYLLADYDDIARKLILAHHTALIDRSTLERWLNEGAHALRSLFSLAQQYRY
SGCTRDDFAAKNAAARVALEKFGELPQDVLEGTRRSTFAPPMVRRGLQQRGENPAAAATS
VDGDAAAAADPSEGAATAGEDESA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccagcaacgaaccattgcaactcaacctcggctccctgcgcagcgcgatgtcg
ctgacgctgcacacgcatcacgcttcccgcatctggcacggccgcgccgccgccgaaggg
cgacccggcatcgtcggcctgaacggctacatcgcggtgatgaataagatgaagcgcggc
tcggagcaggacgacccctacagcgactggtggatgctgcgcatcgaggacaagctcgac
cagaccaggaccacgctgcagaccttgcgcaaacaagtggaccaggcactggcgggcgtg
cctgcggcattgagcctgggcgagaacctcaacgtgcagcccgtcaagctgccgctgttc
gtcaatgcgcagttgggctttgccgccgtctatctcctggccgactacgacgacatcgcg
cgcaagctgatcctcgcccaccacaccgcgctgatcgaccgcagcactttggagcgctgg
ctcaacgagggcgcgcacgcgctgcgcagcctgttctcgctggcccagcagtaccgctac
tcgggctgcacccgcgacgatttcgcggcgaagaatgccgcagcgcgggtcgcgctggag
aagttcggcgagttgccgcaggacgtcctcgaaggcacgcgccgctcgacgtttgcgcca
cccatggtgcgccgtggtctgcaacagcgcggtgagaatcctgccgcagccgctaccagc
gtcgatggtgatgcggccgctgctgccgacccgtccgaaggcgcagccactgccggcgag
gacgaatccgcatga

DBGET integrated database retrieval system