KEGG   Aeromonas sp. ASNIH3: C2U39_00650
Entry
C2U39_00650       CDS       T05427                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_00650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_00650
Enzymes [BR:aea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C2U39_00650
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     C2U39_00650
SSDB
Motif
Pfam: Helicase_C RecG_wedge DEAD ResIII tRNA_anti-codon AAA_30 SecA_DEAD IMS_HHH SNF2_N IstB_IS21
Other DBs
NCBI-ProteinID: AUV10830
UniProt: A0A2I8QXA8
LinkDB
Position
complement(118337..120409)
AA seq 690 aa
MMKLDKISLDSLKGVGSKMLEKLERLGLATVQDLLFHLPLRYEDRTQVWPIGDLPPGLHG
AVEGEIQDTQLVMGRRRMLVCRISDGTGSLTLRFFNFTAAQKNSLAQGRLIRCFGETRPG
KYGLEMAHPEYKLLGEEQAGQTEEALTPVYPTTEGLRQLTLRSLTDQALAQLDLYGVEEL
LPAGLYPQQIDLAAALKLLHRPPPSVALALLESGQHPAQQRLVLEELLAHNLSVLKVRAQ
AQNQLARALKPAPKLVEQLLGALPFTPTGAQSRVVAEIARDLQQSHPMMRLVQGDVGSGK
TLVAALAALQAIGNGCQVGLMAPTELLAEQHAINFARWLEPLGIKVGWLAGKQKGKAREE
ALAAIADGSVKMVVGTHAIFQEQVVFQRLALVIIDEQHRFGVHQRLALREKGEREGVHPH
QLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPITTVALPDSRRQDVIERVRLACEEG
KQAYWVCTLIEESEVLECQAAEDTAAELQTLLPGLHIGLVHGRMRPLEKQRVMEEFKAGI
LQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSVASHCVLLYHAPLS
KTAQSRLGVLRETNDGFLIAQRDLELRGPGELLGTRQTGLADLKIADLVRDQPLIPQVQK
MARFLMDKHPAHVEPLIRRWLGLRDHYSNA
NT seq 2073 nt   +upstreamnt  +downstreamnt
ttgatgaaattggataaaatctctctcgatagcctcaagggtgtcggcagcaagatgctg
gagaaactcgagcggctggggctggccacggtgcaggatctgctgttccacctccccctg
cgctacgaggaccgcacccaggtgtggcccatcggcgatctgccgcccggcctgcacggt
gccgtcgagggcgagatccaggacacccagctggtgatggggcgccgccgcatgctggtg
tgccgtatcagcgacggcaccggcagcctgaccctgcgcttcttcaatttcaccgctgcc
cagaaaaacagcctggcccagggccgccttatccgctgcttcggcgagacccgtcccggc
aagtacggcctggagatggcccaccccgagtacaagctgctcggcgaggagcaggccggc
cagaccgaagaggccctcacccccgtctaccccaccacagaggggctgcgccagctcacc
ctgcgcagcctcacggatcaggccctggcccagctcgacctctacggggtcgaggagctg
ctgcctgccggcctctatccccagcagatcgatctggccgcggccctgaagctgctgcac
cgcccgcctccctcggtggcgctggccctgctcgagagcggccagcacccggcacagcag
cggctggtactggaagagctgctggcccacaacctctcggtcttgaaggtacgcgcccag
gctcagaaccagctcgcccgcgccctcaaacccgcacccaagctggtcgaacagctgctc
ggcgccctgccgttcacccccaccggcgcccagagccgggtggtggcggagatagccagg
gatctgcaacagagccaccccatgatgcggctggtgcagggggacgtgggctcaggtaaa
acgctggtcgcggcgctggccgccctgcaggccatcggcaacggctgccaggtggggctg
atggccccgaccgagctgctggccgaacagcacgccatcaacttcgccaggtggctggag
ccgctcggcatcaaggtgggctggctggcgggcaagcagaagggcaaggcgcgggaagag
gcgctggccgccatcgcggacggcagtgtcaagatggtggtgggcacccacgccatcttc
caggagcaggtggtattccagcgcctcgccctggtcatcatcgatgaacagcacaggttc
ggggtgcatcagcgcctcgccctgcgagaaaaaggagagcgggaaggggtacatccccat
cagctcatcatgaccgccacccccatcccccgcaccctggcgatgaccgcctatgcggac
ctcgacacctcggtcatcgacgaactgccgccgggccgcactcccattaccacggtcgcc
ctgccggacagtcgccgccaggatgtgatcgagcgggtgaggctcgcctgcgaggagggc
aagcaggcctactgggtctgcaccctgatcgaggagtcggaggtgctggagtgccaggcc
gccgaagacaccgccgccgagctgcaaaccctgctgcccggcctgcacatcggcctggta
cacggccggatgcgccccctcgagaaacagcgggtgatggaggagttcaaggcgggcata
ctgcaactgctggtcgccaccaccgtcatcgaggtgggggtggatgtgcccaatgccagc
ctgatgatcatcgaaaacccggagcggctggggctggcccagttgcaccagctgcgcggc
cgggtcgggcgggggtcggtggcctcccactgcgtgctgctctatcatgcccccttgtcc
aagaccgcccagagccgcctcggggtactgcgggagaccaatgacggctttctcatcgcc
cagcgagatctggaactgcgtggcccaggcgagctgctcggtacccgccagaccggcctg
gccgatctcaagatcgccgatctggtgcgcgaccagccgctcatccctcaggtgcagaag
atggcgcgcttcctgatggacaaacacccggcgcatgtcgagcccctgatccgccgctgg
ctgggcctgcgagaccactactccaatgcttga

KEGG   Aeromonas sp. ASNIH3: C2U39_05995
Entry
C2U39_05995       CDS       T05427                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_05995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_05995
Enzymes [BR:aea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C2U39_05995
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     C2U39_05995
SSDB
Motif
Pfam: AlbA_2 HATPase_c_4
Other DBs
NCBI-ProteinID: AUV11766
UniProt: A0A2I8QZY4
LinkDB
Position
complement(1199552..1200715)
AA seq 387 aa
METTELIDCLSRGEDSRHQFKENFTNADALAAEIVAFANTAGGRIFIGVHNDGTVLGLSH
ADIDRLNQLISNSASQNVRPAVNPLTENVPHPNGTVMVVTVVEGVSKPYMDKNGAIWVKN
GSDKRRATSREEIQRLFQQAGLVHADETPVAGLSAGDVDLPYFETFFEQQFGEPLAQHNQ
PLPQLLTNMNLMNQGQLNVAGSLLFAKAPQYALPAFIVRAVAFVGNEIEDQRYIDSRDIT
GKLADVFQQSLGFIIANTRATQGEQGFNSQGQAEIPRIVWEELVANALIHRDYFISAPVR
VLVFADRVEIISPGHLPNNLTIENIKAGNSNMRNPILASFAAKLLPYRGLGSGLLRALRA
WPQIELIDDRAGNLFKAIVARPQEQAA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaaaccacagaactgatcgactgcttgagccgtggcgaagacagccgccatcagttc
aaagagaacttcaccaatgccgacgcgctggcggcggagatcgtggccttcgccaacacc
gctggcgggcggattttcattggcgtgcataacgacggcacggtgctgggcttgtctcac
gcggacattgaccgcctgaaccagctcatctccaacagcgcctcgcaaaatgtgcggcct
gcggtgaacccgctcaccgaaaatgtgccgcaccccaacggcaccgtgatggtggtcacc
gttgtggaaggcgtcagcaaaccctacatggacaagaacggagccatctgggtgaagaac
ggctcggacaagcgccgcgccacctcgcgtgaagaaatccagcgcctgttccaacaggcg
ggtctggtacatgcggatgagacgcctgtggcgggcttgagcgcgggcgatgtggacctg
ccctatttcgaaactttcttcgaacagcaattcggcgaaccgctcgcccagcacaaccag
ccgctgccgcagctcttgaccaacatgaacctgatgaaccaggggcagctcaatgtggcg
ggcagcctgctgtttgccaaagcgccgcagtacgcactgcctgccttcatcgtcagggcg
gtggcttttgtcggcaatgagatcgaagaccagcgctatatcgacagccgcgacatcacc
ggcaagctagccgatgtgttccagcagtcgctgggtttcatcatcgccaacacgcgcgcc
actcagggcgagcagggctttaactcacaagggcaggccgagattccccgcattgtctgg
gaggagctggtcgctaacgcgctcatccaccgcgactatttcatcagcgcgccggtgcgc
gtgttggtgtttgccgatcgggtcgagatcatcagccctggtcatctgcccaacaacctg
accatcgaaaacatcaaggcgggcaactccaatatgcgcaacccgattctggcgtccttt
gccgccaagctgctgccctatcgcggactgggtagcggtctgctgcgcgccttgcgggcc
tggccgcagattgaactgatcgacgaccgggcggggaacctgttcaaggccatcgtggca
cggccacaggagcaagcggcatga

DBGET integrated database retrieval system