KEGG   Aeromonas sp. ASNIH3: C2U39_02035
Entry
C2U39_02035       CDS       T05427                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_02035
   03430 Mismatch repair
    C2U39_02035
   03440 Homologous recombination
    C2U39_02035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_02035
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_02035
   03029 Mitochondrial biogenesis [BR:aea03029]
    C2U39_02035
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    C2U39_02035
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     C2U39_02035
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    C2U39_02035
Mitochondrial biogenesis [BR:aea03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    C2U39_02035
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: AUV11082
UniProt: A0A2I8QXZ2
LinkDB
Position
complement(396419..396988)
AA seq 189 aa
MASRGINKVILIGNLGQDPEVRYMPSGGAVTNITLATSDTWRDKQTGEQKERTEWHRVVF
MGKLAEVAGEYLKKGSQVYVEGKLQTRKWQDQSGQERYTTEVLVDSFTGVMQMLGGRPQG
GGQGMGGQSSQGNWGQPQQAAPQQNMQRPAAPQQNMQPQGGYGRPAQQPQSAPPVYNEPP
MDFDDDIPF
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccagtcgaggcatcaacaaagtcattctgatcggtaacctggggcaagacccggaa
gtgcgctacatgccgagcggcggtgccgtgactaacatcaccctggccacctccgatacc
tggcgcgacaagcagaccggtgagcagaaagagcgcactgaatggcaccgtgtcgtcttc
atgggcaagctggccgaagtggccggcgagtacctgaagaagggctcccaggtctatgtg
gaaggcaagctccagacccgtaaatggcaggatcagagcggccaggagcgctacaccacc
gaggtgctggtcgacagcttcaccggtgtgatgcagatgctgggtggccgtccgcagggc
ggtggccagggcatgggcggccagtcatcccagggcaactggggccagccgcaacaggct
gcaccgcaacagaacatgcaacgtcctgctgccccgcagcagaacatgcaaccgcaaggc
ggttacggccgtccggcccagcagccgcaatccgccccgccggtctacaacgaaccgccg
atggatttcgacgacgatattccgttctga

KEGG   Aeromonas sp. ASNIH3: C2U39_15365
Entry
C2U39_15365       CDS       T05427                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_15365
   03430 Mismatch repair
    C2U39_15365
   03440 Homologous recombination
    C2U39_15365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_15365
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_15365
   03029 Mitochondrial biogenesis [BR:aea03029]
    C2U39_15365
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    C2U39_15365
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     C2U39_15365
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    C2U39_15365
Mitochondrial biogenesis [BR:aea03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    C2U39_15365
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: AUV13407
UniProt: A0A2I8R4I8
LinkDB
Position
3265377..3265760
AA seq 127 aa
MSTHFVGEGNIGSAPEYREFPNGNDEPRRLLRLNVYFDNPIPKKDGEYEDRGGFWAPVEL
WHRDANHWQSLYQKGMRVLVEGRTVRDEWEDADENERVTFKIEARRVGILPYRIEAVTLG
AKPAGGQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagcacgcatttcgtcggcgagggcaatatcggttctgcgccagagtaccgcgaattc
cccaacggcaacgacgaaccgcgcaggctgctgcgcctgaacgtctatttcgacaacccc
atcccgaaaaaggatggcgagtacgaggatcgtggcggcttctgggcgccggtggaactg
tggcaccgcgacgccaaccactggcagtcgctgtatcagaagggcatgcgcgtgctggtc
gaaggccgtaccgtgcgtgacgaatgggaggacgccgacgagaacgagcgcgtgaccttc
aagatcgaggcccggcgcgtcggcatcctgccatatcgcatcgaggcggtaacgctcggc
gccaagcccgctgggggccagtga

KEGG   Aeromonas sp. ASNIH3: C2U39_23625
Entry
C2U39_23625       CDS       T05427                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03030  DNA replication
aea03430  Mismatch repair
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C2U39_23625
   03430 Mismatch repair
    C2U39_23625
   03440 Homologous recombination
    C2U39_23625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aea03032]
    C2U39_23625
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_23625
   03029 Mitochondrial biogenesis [BR:aea03029]
    C2U39_23625
DNA replication proteins [BR:aea03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    C2U39_23625
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     C2U39_23625
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    C2U39_23625
Mitochondrial biogenesis [BR:aea03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    C2U39_23625
SSDB
Motif
Pfam: SSB DUF4792
Other DBs
NCBI-ProteinID: AUV15135
UniProt: A0A2I8RA45
LinkDB
Position
pKPC-8e09:98157..98687
AA seq 176 aa
MMSKGVNKVILVGNLGSDPEIRYMPSGTAVANFNVATTDTWRDKQSGEQREHTEWHRIVL
KGRLAEVAGEYLKKGSQVYLEGSNRTRKWTDSQQIERYTTEVHCVEMQMLGGRGNAPQDN
SQRAAPQKGQRTGAGTQSAPVQQSAPQGGMGGGYGPAPDGWDDDIPFMRLHHLAGG
NT seq 531 nt   +upstreamnt  +downstreamnt
atgatgtctaaaggcgtcaacaaagtaattctggtcggtaatctcggttctgacccggaa
attcgctacatgccaagcggaactgccgttgccaacttcaacgttgcaacaacggatacg
tggcgcgataagcagtctggcgagcaaagagagcatactgagtggcaccgtattgtgctt
aaaggtcgtttggcagaagtcgctggtgagtacctgaaaaagggctcccaagtctatctc
gaagggagcaaccgcacccggaagtggactgacagccaacaaatcgagcgctacaccacc
gaagtacactgcgttgaaatgcagatgcttggtggtcgtggaaatgcacctcaggacaac
tctcaacgtgcagcgccccaaaaagggcaacgtacaggagccggtacgcaatctgctcct
gtgcagcaatcagcaccgcaaggtggtatgggcggaggctatggtcccgctcctgatggc
tgggatgatgacatcccgttcatgcggctgcaccacttggctggcgggtaa

DBGET integrated database retrieval system