KEGG   Aeromonas sp. ASNIH3: C2U39_03680
Entry
C2U39_03680       CDS       T05427                                 

Gene name
recO
Definition
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_03680 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_03680 (recO)
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     C2U39_03680 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C2U39_03680 (recO)
SSDB
Motif
Pfam: RecO_N RecO_C RecO_N_2
Other DBs
NCBI-ProteinID: AUV11373
UniProt: A0A2I8QYZ0
LinkDB
Position
720053..720763
AA seq 236 aa
MLTPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSSLKGLLQPFTLLTIAWRG
KGDLKNLTQVECPDHSLRLGGDRLFYGLYLNELVYYLLEAHTPFPEVFDAYARAIMALAD
GETPEVPLRRFEFLLLQALGYAVDFEYAADDDSPIDPTLLYGFERELGFVACERAPDPRT
LFLGAHLLAFAEGRFDTPPLLQAAKRFSRLALQPYLGKRQLKSRELFLKRKGSVSS
NT seq 711 nt   +upstreamnt  +downstreamnt
ttgctgaccccggctttcgtcatccacagtcggccctatcgggagaccagccagctggtc
gaggtcttcacccaggatagcggtcgattcaccctggtggctcgcggttcccgcgggcca
cgctcctctctgaaggggctgcttcagcccttcaccctgctcaccattgcctggcgcggc
aagggggatctcaagaacctcacccaggtggagtgcccggatcactcgttgcgcctcggc
ggggatcgtctcttctacggcctctatctcaacgagctggtctactacctgctggaagcg
cacacccccttccccgaggtgttcgacgcctatgcccgtgccatcatggcgctggcggac
ggcgagaccccggaggtgcccctgcgccgcttcgagttcctgctgctgcaggccctgggc
tacgcggtggacttcgaatatgccgcagacgacgactcccccatcgaccccaccctgctc
tacggcttcgagcgggagctcggctttgtcgcttgcgagcgggcgccggatccccgtacc
ctgttcctcggcgcccacctgctggccttcgccgaggggcgcttcgacacgccccccttg
ctgcaggcggccaagcgtttcagccggctggcgctgcagccctatctcggcaagcgtcaa
ctgaagagcagggagctctttttgaagcgaaaaggcagtgtttcaagctga

DBGET integrated database retrieval system