KEGG   Aeromonas sp. ASNIH3: C2U39_04220
Entry
C2U39_04220       CDS       T05427                                 

Definition
(GenBank) hypothetical protein
  KO
K02317  DNA replication protein DnaT
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_04220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_04220
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_04220
SSDB
Motif
Pfam: DnaT
Other DBs
NCBI-ProteinID: AUV14692
UniProt: A0A2I8R860
LinkDB
Position
complement(830591..831265)
AA seq 224 aa
MTPAEYSALAHPRLSHPARSLYTLQLRRLVLENRLARLNYPELGRALAVVDPGNPGGFSY
QVNARQLTELLDELMEAELLQVEAQADSEHYHQCPFQLPLLSQRVRSPLPARPFQMHLQW
RPDEELPALARLCGVIDASYSEEDLGEFIAYWLGRPEVFDSQHQWMLKFIRALKSRRYAR
RPATVVTGYQQVAPAPVEAGPSRRAQEMIDEAKRLAQAQEPEND
NT seq 675 nt   +upstreamnt  +downstreamnt
atgacgccagccgaatacagcgccctcgcccatcccagactctcccatccggcccgcagc
ctctataccctgcaactgcgccgcttggtgctggaaaatcggctggcccgactcaactat
cccgagcttggcagggcacttgctgtcgtcgatccgggcaatcccggtggtttcagctat
caggtcaacgctcgccagctgaccgaactgctcgacgagctgatggaggccgaactgctt
caggtcgaggcccaggctgacagtgagcactaccaccagtgccctttccagttgccgttg
ctgagccagcgggtgcgcagccctctgccggcacgcccgttccagatgcacctgcagtgg
cgtccggacgaagaactgcctgctctcgcacgcctgtgcggggtgatcgatgccagctac
agcgaagaggatctcggggagttcatcgcctattggctcggccgccccgaggtgttcgac
tcccagcaccagtggatgttgaaatttattcgggccctcaagagtcggcgctacgcccgc
cgtccggcgaccgtggtcaccgggtaccagcaggtcgcgccagccccggtagaggctggc
ccgagccgccgggcgcaagagatgatcgatgaggccaaacggctggcacaagctcaggag
ccggagaatgattga

DBGET integrated database retrieval system