KEGG   Aeromonas sp. ASNIH3: C2U39_19945
Entry
C2U39_19945       CDS       T05427                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_19945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_19945
Enzymes [BR:aea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C2U39_19945
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C2U39_19945
SSDB
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 SH3_13 AAA_22 UvrD-helicase AAA_16 UvrD_C AAA_28 CbiA PhoH T2SSE NTPase_1 SRP54 AAA_24 DUF2075
Other DBs
NCBI-ProteinID: AUV14204
UniProt: A0A2I8R7A7
LinkDB
Position
complement(4236586..4238640)
AA seq 684 aa
MKGETMIERLKALALAGRIRQLDLQFARLVADLGGSPELVLGAALACHELGRGHVCLPLA
MLAQGGDGQGSSRPFGLDPDQSRDLLADLADPASWPALFAASPLVGSEQEEGELPRWPLR
LWGERLYLTRYHDFELGVARHLSALSERTEWPEIAPALSRLFARDYGLVFGALLKARLAP
DFSVRHFVEKYLDLVFPHEVEWPAVETLLKSAQAASELERLDTLVPEALCCNGQKLAAAT
AAARPFAVISGGPGTGKTTTVAKLLAILVETGLQGGKAPAIRLVAPTGKAAARLTESIGA
ALQALDLPPEWVEAIPTEAGTLHRLLGVIPGRSQFRHHRGNPLHLDLLVVDEASMVDLPM
MARLLDALPSHARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGYRLQ
GTPSGASVRDSLCLLSKSWRFDQHSGIGQLARACNSGDGAAVEAVWGAGFGDIRLHPWAG
EAYNALIAEGVAGYGSYLKAARAGEDPAAVFKAFNGFQILCALRDGPFGVTGLNERLELA
LAKAGLIQRDGDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDETGRLKVWFEQPDGTLRAL
LPSRLPPHETVYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKARLDLYGD
RALLAQAVRKKTERYSGLAERLGE
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgaagggcgaaaccatgatagagcggctgaaagccttggcgctggcggggcgcatccgc
cagcttgacctgcaatttgccaggctggtggccgacctgggcggcagccccgagctggtg
ctgggggccgcactcgcctgccatgagctggggcgcggccatgtctgcctgccgctggcg
atgctcgctcagggcggtgacgggcagggatcctcgcgccccttcgggctggatccggat
cagagccgggatctgctggcggatctcgcggatcccgcgagctggcccgccctctttgcg
gccagccccctggtggggagcgaacaggaggagggagagctcccccgctggcccctgcga
ctctggggggagcgcctctacctcacccgctaccacgactttgagctgggggtggcccgc
caccttagcgccttgagtgaacggaccgaatggccggagattgccccggccctgtcacgc
ctctttgcccgcgactacggcctggtattcggggccctgctcaaggcccgcctcgcgccg
gatttctccgtccgccactttgtggagaagtacctggatctggtcttcccccatgaggtg
gagtggcccgccgtggagaccctgctaaagagcgcccaggcggccagcgagctggagcgg
ctggataccctggtgcccgaggcgctctgctgcaacggccagaagctggcggcggccacg
gcggcggcgcgtcccttcgcggtcatctccggcggccccggcaccggcaagaccaccacg
gtggccaagctcctcgccatcctggtggagaccggcctgcaagggggcaaggccccggcg
atccggctggtggcccccaccggcaaggcggcggcgcgtctgaccgagagtatcggcgct
gccctgcaggcgctggacttgccccccgagtgggtggaggccatccccaccgaggcgggc
accctgcaccggctgctcggggtgatccccgggcgcagccagttccgccatcacagaggc
aacccgctgcacctcgacctgctggtggtggacgaggcctccatggtggacctgcccatg
atggcgcgcctgctggatgcgctgccgagccatgcccgcctcatcctgctcggcgacaag
gatcagctcgcctcggtggaggcgggggccgtgctcggggatatctgcagctttatcgaa
cagggcatcagccccgcgcaggcggattggctctcccgccagaccggctatcgcctgcaa
ggcacgccatcaggggccagcgtgcgcgacagcctctgtttgctctccaagagctggcgc
tttgaccagcattcgggcatcggccagttggcgcgggcctgcaacagcggcgacggggcg
gcagtggaggcggtctggggcgcaggatttggcgacatccgcctgcacccctgggcgggg
gaggcttacaacgccttgatcgcagagggggtggccggttatggcagctacctcaaggcg
gcccgggccggcgaggatccggcggcggtgttcaaggcgttcaacggcttccagatcctc
tgcgccctgcgggacggccccttcggggtgacggggctcaacgagcggctcgaactggcc
ctcgccaaggcagggctgatccagcgtgacggcgactggtatgcgggccgccccgtgatg
gtggtgcgcaacgaccacggggtgggcctctacaacggcgacatggggctctgcctgccg
gatgagaccgggcggctcaaggtatggttcgagcagccggacggcaccctgcgggccctg
ctgcccagccggttgcccccccatgagacggtctacgccatgaccatccacaaatcccag
ggctcggagtttgcccacaccgtgctggtgctgcccgacagccccagcccgctcctgacc
cgcgagctggtctacaccggcatcacccgcgccaaggcccgcctcgatctctacggcgat
cgcgccctgctggcacaggccgtgcggaaaaagaccgagcggtattcgggattggcggag
aggctgggggagtga

DBGET integrated database retrieval system