KEGG   Aeromonas sp. ASNIH3: C2U39_22240
Entry
C2U39_22240       CDS       T05427                                 

Definition
(GenBank) DNA replication and repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
aea  Aeromonas sp. ASNIH3
Pathway
aea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    C2U39_22240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aea03400]
    C2U39_22240
DNA repair and recombination proteins [BR:aea03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     C2U39_22240
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 AAA_27 AAA_29 DUF2813 ABC_tran AAA_16 Zeta_toxin
Other DBs
NCBI-ProteinID: AUV14588
UniProt: A0A2I8R7U7
LinkDB
Position
4715607..4716710
AA seq 367 aa
MSLVKLQLSDFRNIQHASLALSPGLNILVGSNGSGKTSVLEAIHYLGLGRSFRTHLTGRV
IRQGERAFTLFAQCELEGRQVPIGLAKDKGGETQLKIAGAQAQRLADLAELLPVQLIHPD
GFSLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNALLRQSTQYRQLAFWDQE
LVRLGGELAGFRASYCQAITPLIKEMTADFLPEFDISLGFYRGWEKDTPLDALLEAGFER
DRSLGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAMRLAQGLYLNQHSSRGCIFL
IDDFASELDVDKRRLLAARLKQCASQVFITAIDTGQLADMMDASDCKLFHVEQGKISETL
EKAESKL
NT seq 1104 nt   +upstreamnt  +downstreamnt
gtgtccctggtcaaactccagctcagcgactttcgcaacattcagcacgccagtctcgcg
ctgtctcccggcctcaatatcctggtcgggagcaacggcagcggcaagaccagcgtgctg
gaagccattcattaccttggtctcggccgctcgtttcgtacccatttgaccgggcgggtc
atccgccagggcgagcgggcctttaccctgtttgcccagtgcgagctggaggggcgtcag
gtgcccatcgggcttgccaaggacaaggggggcgaaacccagctcaagatcgccggtgcc
caggcccagcgcctggccgatctggcggagctgttgccggtacagttgatccaccccgat
ggtttcagcctgctgaccggtgggccccaggctcgccgggcctggctggactggggtgtt
ttccatcaggagccgaccttcttctccctctgggggcgggtgcgtcggctgttgaagcag
cgcaatgccttgctgcgccagagcacccagtatcgtcaactggcattctgggatcaggag
ctggtgcgactgggtggcgagctggcggggtttcgcgccagttattgtcaggccattacg
cccctgatcaaggagatgacggcagattttctgccggagttcgatatcagtcttggattc
tatcgaggctgggaaaaagacactcccctcgatgcattgctggaggcggggttcgaacgg
gatcgttcgctggggtacactggggtcggtccgcagaaggcggacgtgcggctcaaggcg
aacggcgtgcccgcgcaggatattttgtccaggggtcagctgaagttgctggtctgtgcc
atgcggctggcccaagggctctatttgaatcaacatagcagccgcggctgtattttttta
attgatgattttgcctctgaactggatgtcgacaaacgtcgtctgctggccgcaaggctg
aagcagtgcgcgtcccaggtgttcatcaccgccatcgataccggtcagctcgcagacatg
atggatgcgagtgactgcaagctgttccacgtggaacaaggcaagatctccgaaacgtta
gagaaggcagagagtaagctatga

DBGET integrated database retrieval system