KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105149652Help
Entry
105149652         CDS       T03917                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00040  Pentose and glucuronate interconversions
aec00051  Fructose and mannose metabolism
aec01100  Metabolic pathways
Module
aec_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105149652
   00051 Fructose and mannose metabolism
    105149652
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105149652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 2-Hacid_dh_C Methyltransf_16 ThiF Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105149652
NCBI-ProteinID: XP_011060519
UniProt: F4WVG1
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MAKDNLSAILYGINDLRLENTSIEEPEDNEVLLEMGCVGICGSDIHYLVNGRIGDFIVKK
PMILGHESSGTVAKLGKNVMNLKIGDRVAIEPGVPCRICSHCKEGRYNLCKDVVFCATPP
VHGNLRRFYKHAADFCFKLPDHISLEEGALLEPLSVGVHACKRGEVGISSKVLILGAGPI
GLVTLLVAKAMGAKKIVITDILQSRLNIAKKLGADVTYLVQKDRSEEDTVTDIHAIFEGE
PNRTIDASGAQSSIRLAILATKSGGVIVLVGMGAPEVQIPLINALIREVDIRGVFRYVND
YGDALDLISSGKIDVKSLVTHNYKLEETKQAFETCRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggacaatctctctgctatactgtatggcatcaacgatttacgcctggaaaac
acgagtatcgaggaaccagaagacaatgaggtgcttcttgaaatgggatgcgtaggaatc
tgtgggtcggacattcattatcttgtcaatggcagaattggcgatttcatagtgaagaaa
cctatgatccttggtcatgagtcctctggaactgttgccaaacttggaaaaaatgttatg
aatttaaagatcggtgatcgcgttgctattgaacctggcgtgccttgcaggatatgttca
cattgtaaagagggacgttataatctgtgcaaagatgttgtcttttgtgcaactccgcct
gtgcacggcaacttaagacgtttctacaaacatgcagctgatttctgtttcaaattgccc
gatcatataagcttagaagaaggagcgcttttagagccattatcggtaggagtacacgct
tgtaaacggggcgaggtcggaatcagttctaaagtattaattctgggagctggtccgatt
ggtttggtgaccttgctggtagccaaagccatgggtgcgaagaaaatagttatcacagat
atcttgcaaagtagactgaacatagcgaagaaacttggcgccgacgtcacgtatctggtg
caaaaggatagatcggaggaggatacagtgactgatattcatgcaatttttgagggtgaa
cctaacagaacgatagatgcatccggcgcacaatcctcgattcgtttagcgattcttgca
accaaatctggtggagtcattgtgttagtgggaatgggtgctccagaagtacaaattcca
ctaataaacgctttaataagagaagttgacatcagaggtgttttccgatacgtaaatgac
tatggcgatgcattggaccttatttcgtctggcaagatagacgtgaagtcgttggtcact
cataattacaagctagaggaaaccaagcaagcatttgagacctgtagaactggagcaggt
ggagctatcaaagttatgattcactgtaaataa

DBGET integrated database retrieval system