KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105149771
Entry
105149771         CDS       T03917                                 

Definition
(RefSeq) collagen alpha chain CG42342 isoform X1
  KO
K16617  collagen, type XIII, alpha
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
KEGG Orthology (KO) [BR:aec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aec00536]
    105149771
Glycosaminoglycan binding proteins [BR:aec00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   105149771
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 105149771
NCBI-ProteinID: XP_011060714
LinkDB
Position
Unknown
AA seq 703 aa
MENDPAAKSWPSGPATGKGSSPSCLEASMPRKFRDGDLRAGTVGLNWALCALCLASFAVS
GVLFYRELGLESRIASLEARCMRVQDPSSPVEVLVQRLKAEMQEQLRQTQRLDSTAIFRP
KRDISECNCPPGPPGEPGPPGKRGKKGKKGDPGEPGAPGVAGTPGKNGFPGPIGLDGPKG
DPGRPGDKGQKGELGSPGFDVLSAVKVNAQGLGLKRSVTTLRGGTLGYAEIVALKGEPGE
PGPPGPPGPPGAEGLPGHEGRQGIPGEVGAPGEKGPPGPIGPIGPTGTPGLAGPKGDKGD
KGDRGFTTTLKGEQFPSGVFEGPPGPPGPPGSPGEKGELGPTGPPGLPGEKGTRGKQGKR
GFKGESGLALARGAPGLPGPKGEPGERGYRGEKGAMGDAGLPGPKGEMGLQGLQGLNGTD
GDPGIQGPPGLPGISGPKGEKGDYGDIGPPGLMGPPGLPGPPGYPGLKGEKGEKGESKYK
KLRRRQGDGTFEMNAGEVIMGPPGPPGPAGTPGLQGPPGIKGDRGHDGAKGDPGEKGAKG
DPGPMGLPGPMGLRGESGKPGDSGKPGAMGSPGLDGMKGAQGEPGTKGERGDPGLPGTDG
IPGAEGPKGEKGAKGESGPPGKRGRKGDKGNKGDQGVPGLDAPCPLGPDGLPLPGCGWRP
PQQDITSTSVPAIEGPEPAETDYEEPEDEYDDYTDPNGNLAEQ
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggagaacgacccggcggccaagtcctggccgtcgggcccggcgacgggcaaaggatca
tcgccgtcctgcctggaggcgtcgatgccgcggaagttccgcgatggagacctccgtgcg
gggaccgtgggcctcaattgggcgctgtgcgccctctgcctcgccagcttcgccgtgtcc
ggcgtgctcttctaccgcgagctcggcttggagtccaggatcgcgagtttggaagcacgc
tgcatgcgcgtccaggatccttcgtcgccggtggaagtcctggtgcagaggcttaaggcg
gagatgcaggagcaactgcggcagacgcaacggctcgattccacagcgatcttcaggccc
aaacgcgacatctccgagtgtaattgtcctccaggtccacccggtgagccgggtccaccc
ggaaagaggggcaagaaagggaaaaagggcgatcccggggagcccggtgcgccgggtgtg
gccgggacgccgggcaagaacggttttccgggacccatcggcttggacgggcccaaaggt
gatccgggccgacctggcgacaaagggcagaagggcgagctgggcagccccggattcgat
gtcttgtccgcagtaaaggtcaatgcacagggattggggttaaagaggtcggtgacgacg
ctccgcggcgggacgctcggctacgcggaaatcgtcgccctcaagggagaaccgggtgaa
cccgggccgccgggaccacccggtccgccaggagccgagggtcttcctggacatgagggc
agacaggggattccgggcgaggtcggcgcaccaggggagaagggcccgcccgggccgatc
ggacccatcggcccgacgggcacgccaggacttgcaggtcccaagggtgacaagggtgat
aaaggcgatcggggcttcacgacgaccttaaagggtgagcagtttccaagtggagtattt
gagggcccacctggtccaccaggaccacctggatctccgggcgagaagggagaactgggc
ccgacaggaccgcccggcctacccggcgagaagggtactcggggaaagcaagggaagagg
ggtttcaagggtgagagcggtttggcattggcgaggggtgcccccggcctgccgggtccg
aagggtgagcccggcgaacggggttaccggggcgaaaagggcgccatgggagacgcgggt
ttaccagggcccaagggagagatgggactgcagggcttgcaggggctcaatggaaccgac
ggcgatcctggtatccaaggaccccccggattaccgggaatatccggacccaaaggtgaa
aagggcgactacggcgatattggtccccccggccttatgggacctccgggtctacccggc
ccaccgggctatcctggattgaaaggcgaaaagggagagaaaggcgaatcgaagtacaaa
aagctcaggcgaagacagggagacggcacgttcgagatgaacgccggggaagtgataatg
ggcccacccggacccccaggacccgctggtacccccggactgcagggcccacccgggatc
aagggtgacagaggacacgatggcgccaagggcgatcctggagaaaagggtgccaaaggg
gatcctggtccgatgggactgcccggccccatgggactgaggggagagtccggaaagccc
ggggattccgggaaacctggcgccatgggatcaccaggattagacggcatgaagggcgcg
cagggcgagccaggaacgaagggagaaagaggagatccgggattgcctggtaccgatgga
attcccggtgcggagggaccgaagggagagaaaggtgccaaaggcgaatctgggccgccg
ggtaaacgcggcagaaaaggcgacaagggcaacaagggagatcaaggtgttccaggattg
gatgccccatgtccgctgggaccggatggactccccttaccgggctgtggctggagacca
ccgcagcaggacatcacgagcacgtccgtgccagcgatcgagggtcctgagcccgcggaa
acggattacgaggagccggaggacgagtacgacgactatacggacccgaacgggaatcta
gctgagcaataa

DBGET integrated database retrieval system