KEGG   Aeromonas sp. CU5: CK911_08230Help
Entry
CK911_08230       CDS       T05327                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00473  D-Alanine metabolism
aem00550  Peptidoglycan biosynthesis
aem01100  Metabolic pathways
aem01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK911_08230
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CK911_08230
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CK911_08230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aem01011]
    CK911_08230
Enzymes [BR:aem01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CK911_08230
Peptidoglycan biosynthesis and degradation proteins [BR:aem01011]
 Precursor biosynthesis
  Amino acid ligase
   CK911_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ATL92786
UniProt: A0A291TI20
LinkDB All DBs
Position
complement(1887455..1888444)
Genome map
AA seq 329 aa AA seqDB search
MKNMHVLLLCGGGGSEHEVSLRSANFLEQQLALLPGIEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLTAIGIPNTPYLFLTEQSDAALADAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAAYQYGDELIATYPGEICVPQDKFYSYEEKYSSA
SHTETSLTAQGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTDEGEILLNEINTFPGM
TSISMFPKLLEHHGHRFADYLEQILRKAS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggcggtggctccgagcacgaagtctct
ctgcgtagcgccaatttcctcgagcaacaactcgctctcctgcccggcatcgaagtgacc
cgtgtcgagatgttcgccgaccgctggctcagtgccgatggccgcgagtgcaagctgggg
ctcgacaagctgctttcgtttgacagcgtggcccgtccggtggattacgtggtgccctgc
attcacggctatccgggtgagaccggcgatctgcaatccttcctcgaactggccggattg
ccttatctcggttgcgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaaa
ctgtggctcaccgccatcggcattcccaacaccccttacctgttcctgaccgagcagagc
gacgcggcccttgctgatgccaaagccgcgctggccaagtggggcaaggtctttatcaag
gccgcctctcagggttcttccgttggctgctactccgccagcaacgaagccgacctggtg
aagggcattgccgatgccttcggttactccgaacaggtgttgatcgaaaaagcggtcaag
ccgcgcgagctcgaagtggcggcctatcagtacggtgacgagctgatcgccacctatccg
ggtgagatctgtgtcccgcaggacaagttctacagctatgaagagaagtacagcagcgcc
agccacaccgaaaccagcctcacggcacaagggctgacccaggcgcaggccgatgcgatc
cacgagtatgccctcaaggcattccgtcagctgaaactgacccacctctcgcgcatcgac
ttcttcctgaccgacgagggcgagatcctgctcaacgagatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcaccgcttcgccgactac
cttgagcagatcctgcgcaaggccagctag

DBGET integrated database retrieval system