KEGG   Aeromonas sp. CU5: CK911_09110Help
Entry
CK911_09110       CDS       T05327                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aem  Aeromonas sp. CU5
Brite
KEGG Orthology (KO) [BR:aem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CK911_09110
Enzymes [BR:aem01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CK911_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMN_bind Glutaredoxin FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ATL92950
UniProt: A0A291TIV7
LinkDB All DBs
Position
2087380..2088960
Genome map
AA seq 526 aa AA seqDB search
MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALASEISEMSPKISMTDGTAARK
PSMSVAAQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADAAVQEQIRHLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQEEVAERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGASERKAAELNEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVTYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGEVEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLTVAGIFVQIGLVPNTEFLKGGEIALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEVTKADAVTA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacagctgaacacctatctgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatctgcagagctgctggcactggcc
agcgagatcagcgagatgtcacccaaaatttccatgaccgatggcactgccgcgcgcaag
ccttccatgagtgtcgcagcacagggccaagccccgcgcgttcactttgccggcattccc
atgggtcatgaatttacctctttggtgctcgccctgctgcaaagcggcggccacccctcc
aaggccgatgcggccgtgcaggagcagatccgccatctcaagggcgagttccacttcgag
acctatatctccctctcctgccacaactgcccggacgtggtgcaggcgctgaacctgatg
gcgaccctgaaccccggcatcactcacaccatgatcgatggcgccctgttccaggaagag
gtcgccgaacgtcaaatcatggcagtaccgaacgtctacctgaacggccaaccattcagc
cagggccgtatctcgctggaagagatcgttgccaagctcgataccggtgccagtgagcgc
aaagcggctgaactcaatgaaaaagcgccctacgacgtgttggtggtgggcggtggcccg
gctggcgcagcggctgccatctatgccgctcgtaaaggcattcgcaccgccatcgtcgcc
gagcgtttcggtggtcaggtgatggacaccgttggcatcgagaactttatctccgtgacc
tacaccgaaggccccaagctggccgccagcctggagcagcacgtcaagcagtacggtgtg
gaagtgatcaccgagcagcgggccgctgccatcagcaaagatggttatgtgaacgtggat
ctcgcctctggcgccaccttgaagagccgcgccgtgatcctggcgaccggggcccgctgg
cgcgatctgaacgtaccgggcgaagtcgagtaccgcaccaagggcgtggcctactgcccg
cactgcgatggccccttcttcaagggcaagcgagtggcggtgatcgggggcggtaactcc
ggcatcgaggctgccatcgatctggctggcatcgtcgagcatgtcaccgtagtggagttt
gccgataccctgcgtgccgacgaggtactgcagaagaaggcccgctccatgggcaatatc
gacatcatcatgagtgctcgcactaccgaagtgatcggtgatggcagcaaggtggtcggc
atggattacgaagatcgcaccaccggtgaaatcaagcacctgacagtggcaggcatcttc
gtccagattggactggtgccgaacaccgagttcctgaaagggggcgagattgccctgacc
cgctttggcgaaattgagatcgataccaaaggcgcgacctccctgccaggtgtctacgcc
gcaggggatgccaccacggtaccgttcaagcagatcattatctccatgggtgccggtgcc
accgccgcactgggggcgtttgattacctgatccgcaacccggcaccggaagtgaccaag
gctgacgcagtgaccgcctga

DBGET integrated database retrieval system