KEGG   Aeromonas sp. ASNIH5: C2U30_02025Help
Entry
C2U30_02025       CDS       T05873                                 

Definition
(GenBank) adenylate cyclase
  KO
K05873  adenylate cyclase, class 2 [EC:4.6.1.1]
Organism
aes  Aeromonas sp. ASNIH5
Pathway
aes00230  Purine metabolism
aes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aes00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2U30_02025
Enzymes [BR:aes01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     C2U30_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH SabA_adhesion
Motif
Other DBs
NCBI-ProteinID: AUT40603
UniProt: A0A2I8CZW3
LinkDB All DBs
Position
complement(477752..478303)
Genome map
AA seq 183 aa AA seqDB search
MTTHFQGRFEVEFKYRLTDSAAFVHTLTALGPEVMVADNHEQDCYFDTADGALARAEKSL
SIRTMAPSGIRLWIVKGPGPDRCEAVNITDADKAASMVRTLGYQPVLTIDKRRSIYFLGA
FHVTVDHLAGVGDFAELAIMTDDETALPAYRAQLLALASRLGLAPEMRETRSYRTLCEQR
VPL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccactttcaggggcgcttcgaggtggagttcaaataccgcctgacggacagc
gccgcctttgtacataccctcacggccctcggccccgaggtgatggtggcggacaatcat
gagcaggactgctacttcgacacggcagatggcgccctggcccgggcagagaagagcctg
agcatccgcaccatggcccccagcggcatccggctctggatagtcaaaggacccggaccc
gatcgctgcgaggcggtcaacatcaccgatgcggacaaggcggccagcatggtgcgcacc
ctgggctaccagccggtgctgaccatcgacaagcggcgcagcatctattttctgggggcc
ttccacgtcacggtggatcacctggcaggcgtcggtgattttgccgagctcgccatcatg
actgacgacgagaccgccctgcccgcctaccgcgcgcagttgctggcgctggctagccgg
ctgggactggcgcccgagatgcgggaaacccgctcctatcgcaccctgtgcgagcagcga
gtccccctttga

DBGET integrated database retrieval system