KEGG   Aeromonas sp. ASNIH5: C2U30_02040Help
Entry
C2U30_02040       CDS       T05873                                 

Definition
(GenBank) acetyltransferase
  KO
K03827  putative acetyltransferase [EC:2.3.1.-]
Organism
aes  Aeromonas sp. ASNIH5
Brite
KEGG Orthology (KO) [BR:aes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U30_02040
Enzymes [BR:aes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     C2U30_02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_9 Acetyltransf_6 Acetyltransf_18 Acetyltransf_4 Acetyltransf_CG Acetyltransf_3 PanZ
Motif
Other DBs
NCBI-ProteinID: AUT40605
UniProt: A0A2I8D066
LinkDB All DBs
Position
480054..480491
Genome map
AA seq 145 aa AA seqDB search
MKIEPAQTGDYPALIALWEASVRATHHFLQEEDIATLKPLILEHYFDAVRLYCARQDGVI
VGFIGVAEGNIEMLFIAPEARGGGVGRQLVDHAIRCLGATRVDVNEQNAQAVGFYQHLGF
EVTGRSPLDGQGKPYPLLHMALAAG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaaccagcacaaaccggggattacccggccctgatcgctctctgggaggcc
tcggtacgcgctacccatcacttcctgcaagaggaggatatcgcgaccctcaagcctctc
atcctcgaacactatttcgatgccgtgcgcctctattgcgccaggcaggatggcgtgatc
gtcggttttatcggggtggctgagggcaatatcgagatgctattcatcgcccccgaggcg
agagggggcggggtcggccgccagctggtggaccacgccatccgttgtctgggggcgact
cgcgtggacgtcaacgaacagaatgcccaggctgtcggcttctaccagcacctgggcttc
gaggtgacggggcgctcccccctggatggccagggcaagccctatccgctgctgcacatg
gccttggccgccggttaa

DBGET integrated database retrieval system