KEGG   Asticcacaulis excentricus: Astex_0699Help
Entry
Astex_0699        CDS       T01378                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aex  Asticcacaulis excentricus
Brite
KEGG Orthology (KO) [BR:aex00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Astex_0699
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Astex_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 DAO Thi4 NAD_binding_8 Glutaredoxin K_oxygenase FMO-like DUF3467
Motif
Other DBs
NCBI-ProteinID: ADU12385
UniProt: E8RRR4
LinkDB All DBs
Position
1:complement(745970..747559)
Genome map
AA seq 529 aa AA seqDB search
MLDDGMKAQLKAYLENLRTPIELVAHTDDQPKSRELVDLLEDIVAASTKVTLTVSSGGER
VPSFDIVRSGSPEVAVTFAGLPMGHEFTSLVLALLWVGGHPPKVEAEVIEQVKALDIEGE
LHFETYFSLSCQNCPDVVQALSLMSVLNPKIKHVAIDGALFKDEVEKRQVMAVPTILLNG
QPFGQGRMGLEQILAKLDTGAQSREAEKISAKSEFDVLVVGGGPAGASAAIYAARKGIRT
GVVAERFGGQVLDTMDIENFISVPHTEGPKLATALEQHVKDYEVDIMNLQTATQLIPAAT
PGGLIEVKLQSGASVKSRTVILSTGARWRNMNVPGETEYKNKGVAYCPHCDGPLFKGKRV
AVIGGGNSGVEAAIDLAGIVAEVTLLEFAAELRADAVLQRKLYSLPNVKVLTNAQTTEVT
GDGSKVTGLRYKDRLHDVAHDIELEGIFVQIGLVPNTEWLKGTLALSKHGEVEVNAKGET
SLPGVFAAGDCTTVPYKQIIIAMGEGSKASLSAFDHLIRSTAPADVIAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgacggcatgaaggcccaactgaaggcctatctcgaaaacctgcgcacaccg
atcgaactggtggcccacaccgatgatcagccaaagtctcgcgagttggtcgatctgctt
gaagacatagtggccgcctcaaccaaggtaaccctgaccgtctcgtccggaggcgaacgc
gtgccttccttcgatatcgttcgcagcggcagccctgaggtcgccgtgacctttgccggc
ctgcccatgggccatgagttcacctctctcgtgctggcgctcctgtgggtcggcggccac
ccgcccaaagtcgaagccgaggtaattgagcaggtcaaggcgctcgatatcgaaggcgaa
ctgcactttgaaacctatttctcgttatcgtgccagaactgccccgacgtggtgcaggcg
ctgagcctgatgagcgtcctgaacccgaagataaagcacgtcgccatcgacggcgcactc
tttaaggacgaggtcgaaaagcgtcaggtcatggctgtgccgaccattctgctgaacggt
cagccctttggtcagggccgaatggggctggagcaaattctggctaagctcgacaccggg
gcgcaatcgcgtgaagccgaaaagatcagcgccaagtcggaattcgacgtcctggtcgtc
ggcggcggccccgccggcgcctcggccgccatctacgccgcgcgcaaaggcatccgcacc
ggtgtcgtggccgagcgctttggcggtcaggtgctcgacaccatggatatcgagaacttc
atctctgtgccccacaccgaaggcccgaagctcgccaccgcgctggagcagcatgtcaag
gactatgaggtcgatatcatgaatctccagactgcgacacaactgataccggcggccacg
cccggcggcctgatcgaggtgaagctgcaaagcggcgcttcggtaaagtcgcgcaccgtc
atcctttcgaccggtgcccgctggcgcaatatgaacgtgcccggtgaaaccgagtacaaa
aacaagggcgtggcgtactgcccacattgcgacggcccgttgttcaagggcaagcgcgtg
gccgtcataggtggcggcaattcaggcgtcgaggcggccattgatctggccggcatcgtc
gccgaagtaaccctgctggagttcgcggccgaactgcgcgccgacgcggtcctgcaacgc
aagctctatagcctgccgaacgtcaaggtgctgaccaatgcccagacgaccgaggtcacg
ggcgacggcagcaaggtaacgggtctgaggtataaggaccgcctgcacgacgtagcgcac
gacatcgaactggaaggcatctttgtgcagattggtctggtgcccaacaccgaatggctg
aaaggcacacttgccctgtcgaagcacggcgaggtcgaggtgaatgccaagggggagacc
tcactgccgggcgttttcgcagcgggcgactgcaccaccgtgccgtacaaacagatcatc
atcgctatgggcgaaggctccaaggcctccctgtcagcctttgatcacctaatccgaagc
acggccccagcggacgtcattgccgcctga

DBGET integrated database retrieval system