KEGG   Addendum: AAF67503
Entry
AAF67503          CDS       T10000                                 

Gene name
novJ
Definition
(KEGG) novobiocin biosynthesis protein NovJ
  KO
K12703  novobiocin biosynthesis protein NovJ
Taxonomy
TAX:193462
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces niveus)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C K-cyclin_vir_C
Other DBs
NCBI-ProteinID: AAF67503
GB: AF170880
UniProt: Q9L9F8
LinkDB
AA seq 262 aa
MTSPADATTEVAVSQESVAMVTGAGRGIGAATAERLAAEGMAVIVVDRTEQDTRATVAAI
RTAGGRARGIGCDVAVAQAVTAAVATAVEEFGRIDVLVNCAGINRDRLLLTMGDQEWDTV
LDVNLGGTMRCSFAVGRHMRRQGHGRIINFSSVAARGNAGQTNYATAKGAIAGFTRTLAA
ELGPHGVTVNAIAPGFVATPMVDELAERLGGDRDSVMSEAAKSSAVGRIGTPEEIAATVV
FVARPESGYLTGETVHVDGGRP
Reference
  Authors
Steffensky M, Muhlenweg A, Wang ZX, Li SM, Heide L
  Title
Identification of the novobiocin biosynthetic gene cluster of Streptomyces spheroides NCIB 11891.
  Journal
Antimicrob Agents Chemother 44:1214-22 (2000)
DOI:10.1128/AAC.44.5.1214-1222.2000

DBGET integrated database retrieval system