KEGG   Addendum: AAO24736
Entry
AAO24736          CDS       T10000                                 

Gene name
pphA
Definition
(KEGG) phosphonopyruvate hydrolase (EC:3.11.1.3)
  KO
K19669  phosphonopyruvate hydrolase [EC:3.11.1.3]
Taxonomy
TAX:218557
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Comamonadaceae; Variovorax
Organism
ag  Addendum (Variovorax sp. Pal2)
SSDB
Motif
Pfam: PEP_mutase ICL
Other DBs
NCBI-ProteinID: AAO24736
GB: AY179862
UniProt: Q84G06
LinkDB
Structure
PDB: 
2HJP 2DUA 2HRW

AA seq 290 aa
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSM
STHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSL
RTDGRQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGA
DAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIR
AAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Reference
  Authors
Kulakova AN, Wisdom GB, Kulakov LA, Quinn JP
  Title
The purification and characterization of phosphonopyruvate hydrolase, a novel carbon-phosphorus bond cleavage enzyme from Variovorax sp Pal2.
  Journal
J Biol Chem 278:23426-31 (2003)
DOI:10.1074/jbc.M301871200
Reference
  Authors
Chen CC, Han Y, Niu W, Kulakova AN, Howard A, Quinn JP, Dunaway-Mariano D, Herzberg O
  Title
Structure and kinetics of phosphonopyruvate hydrolase from Variovorax sp. Pal2: new insight into the divergence of catalysis within the PEP mutase/isocitrate lyase superfamily.
  Journal
Biochemistry 45:11491-504 (2006)
DOI:10.1021/bi061208l

DBGET integrated database retrieval system