KEGG   Addendum: ADB04304
Entry
ADB04304          CDS       T10000                                 

Gene name
bnsG
Definition
(KEGG) naphthyl-2-methylsuccinyl-CoA dehydrogenase
  KO
K15571  naphthyl-2-methylsuccinyl-CoA dehydrogenase [EC:1.3.99.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: ADB04304
GB: GU080107
UniProt: D2XBI5
LinkDB
AA seq 411 aa
MDFSIPEEYMMLKESMREFVKREMMPLEKTLLERELSLWSKPGPLIPEEDHQRLLQKAKE
LGFWGLEVEEKFGGQGLGMLAKTLVVEEMCKCLVGFSPHAFTLPPDAPNLYYLNDCCSEV
QREKYYKPYCDGKLDSAMACTEPGAGSDVSGLKTKAVKKGDKWVINGTKTFTSKCDYPSV
FFILIAVTDSEASSKNKFTAFLIDREHPGVRIGREIPVIGAMPTWDLILEDVEVGDDAVL
GDVGKAFVPLQNRFGVRRIELASRCTGMAERLIQMMIDQANNRVTFGKPLAERGVVQNWI
ADSTIELESVRWLLYYAAWKSDQGYKDLRIEGASVKVAATEMLTRIADRAIQVHGGLGVS
SELGIEHVARMVRIWRILEGPSEIHRWLVARQILGQKKIYSPFVVAKDEDI
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system