KEGG   Addendum: CAD47941
Entry
CAD47941          CDS       T10000                                 

Gene name
pnh
Definition
(KEGG) 2,6-dihydroxypseudooxynicotine hydrolase (EC:3.7.1.19)
  KO
K19188  2,6-dihydroxypseudooxynicotine hydrolase [EC:3.7.1.19]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB
Motif
Pfam: DUF1100 Peptidase_S9 Hydrolase_4 DLH Peptidase_S15 Abhydrolase_1 BAAT_C Esterase UPF0227 AXE1
Other DBs
NCBI-ProteinID: CAD47941
GB: AJ507836
UniProt: Q93NG6
LinkDB
Structure
PDB: 
2JBW

AA seq 367 aa
MTVTSQVKPEDEMLNWGRLILDGVSYSDMVGARDRPKEITWFDYWMSLANEYEQEAERKV
ALGHDLSAGELLMSAALCAQYAQFLWFDERRQKGQARKVELYQKAAPLLSPPAERHELVV
DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMF
EYKRIAGDYEKYTSAVVDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWG
GFSDLDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHD
EVPLSFVDTVLELVPAEHLNLVVEKDGDHCCHNLGIRPRLEMADWLYDVLVAGKKVAPTM
KGWPLNG
Reference
  Authors
Igloi GL, Brandsch R
  Title
Sequence of the 165-kilobase catabolic plasmid pAO1 from Arthrobacter nicotinovorans and identification of a pAO1-dependent nicotine uptake system.
  Journal
J Bacteriol 185:1976-86 (2003)
DOI:10.1128/JB.185.6.1976-1986.2003
Reference
  Authors
Sachelaru P, Schiltz E, Igloi GL, Brandsch R.
  Title
An alpha/beta-fold C--C bond hydrolase is involved in a central step of nicotine catabolism by Arthrobacter nicotinovorans.
  Journal
J Bacteriol 187:8516-9 (2005)
DOI:10.1128/JB.187.24.8516-8519.2005
Reference
  Authors
Schleberger C, Sachelaru P, Brandsch R, Schulz GE
  Title
Structure and action of a C-C bond cleaving alpha/beta-hydrolase involved in nicotine degradation.
  Journal
J Mol Biol 367:409-18 (2007)
DOI:10.1016/j.jmb.2006.12.068

DBGET integrated database retrieval system