Agathobaculum sp. NTUH-O15-33: RWV98_03820 Help Entry RWV98_03820       CDS       T09495                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agat  Agathobaculum sp. NTUH-O15-33 Pathway agat01100   Metabolic pathways agat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RWV98_03820 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RWV98_03820 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Delta_lysin Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WNX85414 LinkDB All DBs Position 718467..718691 Genome browser AA seq 74 aa AA seqDB search MFEKICELLADKFDADASTMTMDTKIKDDLNADSLDVVELMMDLEESFGITISDEEATQM STIGDIVKYIEANQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtttgaaaagatttgcgagctgctggccgataagttcgacgccgacgcttccaccatg accatggacaccaagatcaaggacgacctgaacgccgattccctcgacgtagtggaactg atgatggacctcgaagagagttttggcatcaccatttccgacgaggaagccacccagatg agcaccatcggcgatatcgtcaagtatatcgaagccaaccagtaa

DBGET integrated database retrieval system