Actinacidiphila glaucinigra: OIE69_17355 Help Entry OIE69_17355       CDS       T09685                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism agla  Actinacidiphila glaucinigra Pathway agla00400   Phenylalanine, tyrosine and tryptophan biosynthesis agla01100   Metabolic pathways agla01110   Biosynthesis of secondary metabolites agla01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:agla00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     OIE69_17355 Enzymes [BR:agla01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      OIE69_17355 BRITE hierarchy Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  WSD60563 LinkDB All DBs Position 3945380..3945658 Genome browser AA seq 92 aa AA seqDB search MSSTPAAPRTTDPGAVIADARERIDDLDARIVALVRERMAVSAGIQRARIESGGRRVHLS REMDILRRYSEQLGRPGTALAMTLLELCRGRV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagcagcacccccgcggcaccgcggaccaccgaccccggcgccgtcatcgcggacgcc cgcgagcggatcgacgacctcgacgcgaggatcgtcgcgctggtgcgggaacggatggcc gtctcggcgggcatccagcgcgcccgcatcgagtccggcggccgccgcgtgcacctctcc cgcgagatggacatcctccgccgctacagcgagcagttgggcaggcccggcacggcactc gccatgaccctgctggagctgtgccgcggccgggtctga

DBGET integrated database retrieval system