KEGG   Agromyces aureus: ATC03_02635Help
Entry
ATC03_02635       CDS       T04413                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
agy  Agromyces aureus
Pathway
agy00250  Alanine, aspartate and glutamate metabolism
agy00280  Valine, leucine and isoleucine degradation
agy00310  Lysine degradation
agy00410  beta-Alanine metabolism
agy00640  Propanoate metabolism
agy00650  Butanoate metabolism
agy01100  Metabolic pathways
agy01120  Microbial metabolism in diverse environments
Module
agy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ATC03_02635
   00650 Butanoate metabolism
    ATC03_02635
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ATC03_02635
   00280 Valine, leucine and isoleucine degradation
    ATC03_02635
   00310 Lysine degradation
    ATC03_02635
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ATC03_02635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:agy01007]
    ATC03_02635
Enzymes [BR:agy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ATC03_02635
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ATC03_02635
    2.6.1.48  5-aminovalerate transaminase
     ATC03_02635
Amino acid related enzymes [BR:agy01007]
 Aminotransferase (transaminase)
  Class III
   ATC03_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANJ25814
UniProt: A0A191WCA6
LinkDB All DBs
Position
617059..618426
Genome map
AA seq 455 aa AA seqDB search
MTIVDTTAATATVTGGPALPQERRLVTAIPGPRSQALMARKAAAVASGVGTTIPIAVVAA
GGGVVVDADGNSIIDLGSGIAVTGVGNANPRVVEAVTAQLNAFTHTCFTVAPYDSYVDVA
EKLNELTPGDHDKRSALFNSGAEAVENAVKIARAYTKKQAVVAFDHAYHGRTNLTMGLTA
KNIPYKNGFGPFAPEVYRVPLSYPFRDGGLSGADAAAKAISQIEKQIGAENLAAMIIEPI
QGEGGFIVPAAGYLPALVEWCRANDVVFIADEVQTGFGRTGAWFASDHEGIVPDLITTAK
GIAGGLPLSAVTGRAEIMDAAGPGGLGGTYTGNPMACVAALAAIEAYEEDGLIERAKEIG
SVLIGRLNALRTTDARIGDVRGRGAMVAIELVDPATGAPDAALTSKVAAYAHSQGVLVLT
CGTYGNVIRFLPPLTISDDLLIEGLQVVAEGLKTA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgtcgacaccacggccgccacggccaccgtcaccggaggaccggcgctcccg
caggagcgtcgtctcgtcaccgccatcccgggcccgcgctcgcaggccctcatggcccgc
aaggccgcagccgtcgcctcgggcgtcggcaccaccatcccgatcgccgtcgtcgccgcg
ggcggcggagtggtcgtcgacgccgacggcaactcgatcatcgacctgggctcgggcatc
gccgtcacgggcgtcggcaacgccaacccgcgcgtcgtcgaggccgtcaccgcccagctc
aacgccttcacgcacacctgcttcaccgtcgcgccctacgactcctacgtcgacgtcgcc
gagaagctcaacgagctcacccccggcgaccacgacaagcgctccgcactgttcaactcc
ggcgccgaagccgtcgagaacgccgtgaagatcgcccgcgcctacacgaagaagcaggcc
gtcgtcgcgttcgaccacgcctaccacggccgcacgaacctcaccatgggcctcaccgcg
aagaacatcccgtacaagaacggcttcggcccgttcgcgcccgaggtgtaccgcgtgccg
ctcagctaccccttccgcgacggcgggctctccggtgcggatgccgcggccaaggccatc
tcgcagatcgagaagcagatcggcgccgagaacctcgccgccatgatcatcgagcccatc
cagggcgagggcggcttcatcgtgcccgccgccggctacctgccggcgctcgtcgagtgg
tgccgcgcgaacgacgtcgtcttcatcgccgacgaggtgcagaccgggttcggccgaacc
ggcgcctggttcgcgagcgaccacgagggcatcgtgcccgacctcatcaccacggccaag
ggcatcgcgggcggcctgccgctctccgcggtcaccggccgcgccgagatcatggacgcg
gcgggccccggcggcctcggcggcacctacaccggcaacccgatggcctgcgtcgccgcg
ctcgccgcgatcgaggcctacgaggaggacggcctgatcgagcgcgccaaggagatcggc
tccgtgctcatcggccgcctgaacgccctgcgcacgaccgacgcccgcatcggcgacgtc
cgcggccgcggcgcgatggtcgcgatcgagctcgtcgaccccgcgaccggcgcacccgac
gccgcgctcacgagcaaggtcgccgcgtacgcccactcgcagggcgtgctcgtgctcacc
tgcggaacctacggcaacgtgatccgcttcctccccccgctcaccatctcggacgacctc
ctcatcgagggcctgcaggtcgtcgcggaaggactcaagacggcatga

DBGET integrated database retrieval system