KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2404Help
Entry
AHA_2404          CDS       T00424                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00473  D-Alanine metabolism
aha00550  Peptidoglycan biosynthesis
aha01100  Metabolic pathways
aha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AHA_2404 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AHA_2404 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AHA_2404 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aha01011]
    AHA_2404 (ddl)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AHA_2404 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:aha01011]
 Precursor biosynthesis
  Amino acid ligase
   AHA_2404 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 4488463
NCBI-ProteinID: YP_856919
UniProt: A0KKW8
LinkDB All DBs
Position
complement(2650996..2651985)
Genome map
AA seq 329 aa AA seqDB search
MKNIHVLLLCGGGGSEHEVSLRSANFLEKQLSLLPGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQNDAALSEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALRAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHRFADYLEQILRKAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatccatgtcttgctgctgtgcggcggcggtggctccgagcacgaagtctcg
ctgcgcagtgccaatttcctcgaaaaacagctctccctcctgcccggcgtggaagtgacc
cgggtcgagatgtttgccgaccgctggctcagcgccgatggccgcgaatgcaagctgggg
ctggacaagctgctgtcgtttgacagcgtggcccggccggtggattacgtggtgccctgc
atccacggctaccctggcgagaccggcgacctgcaatccttcctcgagctggcgggcctg
ccttatctgggctgcgacgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctccgccatcggcatccccaacaccccttatctgttcctgaccgagcagaac
gacgcggcgctgagcgaggcgaaagccgcgctggccaagtggggcaaggtcttcatcaag
gcggcctcccagggctcttccgttggctgctactccgccagcaacgaagcggatctggtg
aagggcattgccgatgccttcggttattccgagcaggtactgatcgaaaaagcggtcaag
ccgcgcgagctggaagtggcggtgtaccagtacggtgacgagctggtggccacctatccg
ggcgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agtcacaccgagaccgcactgcgcgccgaggggctgacccaggcgcaggctgacgccatt
cacgagtacgcgctcaaggcgttccgtcagctcaaactgacccacctgtcgcgtatcgac
ttcttcctgaccgaagagggcgagatcctgctgaacgaaatcaataccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcaccgcttcgccgactac
cttgagcagatcctgcgcaaggcggtctga

DBGET integrated database retrieval system