KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_4068
Entry
AHA_4068          CDS       T00424                                 

Gene name
asnA
Definition
(RefSeq) asparagine synthetase AsnA
  KO
K01914  aspartate--ammonia ligase [EC:6.3.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00460  Cyanoamino acid metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_4068 (asnA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AHA_4068 (asnA)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.1  aspartate---ammonia ligase
     AHA_4068 (asnA)
SSDB
Motif
Pfam: AsnA tRNA-synt_2 Thump_like
Other DBs
NCBI-GeneID: 4487440
NCBI-ProteinID: YP_858493
UniProt: A0KQE2
LinkDB
Position
4502900..4504012
AA seq 370 aa
MPVYFEEKNTQSLFLLSNIEFSWQSVEESSHPTGSRQVFSMKQHYIRSQQQISFVKEMFS
RQLAQQLGLMEVQAPILSRVGDGTQDNLSGHENAVQVKVKTLPEHSYEVVHSLAKWKRQT
LGRFGFGPGEGIYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMPSERRDLAYLQETVRGI
WAAIKATERAVCAEHELTPFLPAEIQFLHSEELLTRYPDLDAKGRERAIAKELGAVFLIG
IGGALSHGERHDVRAPDYDDWSSHSELGLAGLNGDILVWNPVLQDSFEISSMGIRVDAEA
LRRQLAITGDEDRLQYDWHQDLLAARMPQTIGGGIGQSRLAMLLLQKEHIGQVQVGVWPA
EMKAAVQGML
NT seq 1113 nt   +upstreamnt  +downstreamnt
ttgccggtgtattttgaagaaaaaaatacacaaagcctatttctattatcgaatattgaa
tttagttggcaatctgttgaagaatcctcacatccaacgggttcaagacaggtattcagc
atgaaacagcactacattcgcagccagcaacagatcagcttcgtcaaagagatgttctcc
cgccaactcgcccagcaactgggtctgatggaggtgcaagcccccatcctgagccgggtc
ggtgatggcactcaagacaacctctctggccacgagaatgcggtgcaggtcaaggtgaag
accctgcctgaacacagctacgaagtggtgcattcgctggccaaatggaagcgccagacc
ctgggtcgcttcggtttcggcccgggcgaaggcatctacacccacatgaaggcgctgcgt
ccggacgaggatcgcctcacccccatccactccgtctacgtggatcagtgggactgggag
aaggtgatgccgagcgagcgccgcgatctggcctacctgcaggaaaccgtgcgcggtatc
tgggctgccatcaaggccaccgagcgcgcggtctgtgccgagcacgagctgactcccttc
ctgccggccgagatccagttcctgcacagcgaagagctgctgacccgctacccggacctc
gatgccaaggggcgcgagcgggccatcgccaaagagctgggggccgtgttcctgattggc
atcggcggtgcactctcccacggcgagcgccacgacgtgcgtgccccggactacgacgac
tggagcagccacagcgagctgggtctggccggtctgaacggtgacatcctggtgtggaac
ccggtactgcaagacagcttcgagatctcctccatggggatccgggtcgacgccgaggcg
ctgcgccgtcagctggccatcaccggcgatgaggatcgcctgcagtacgactggcaccag
gatctgctggccgcacggatgccgcaaaccatcggcggcggcatcggccaatcccgtctg
gccatgctgctgctgcaaaaagagcacatcggccaggtccaggtcggcgtctggccggcc
gagatgaaagccgccgtgcaaggcatgctgtaa

DBGET integrated database retrieval system