Aeromonas hydrophila AL06-06: RY45_17500 Help Entry RY45_17500        CDS       T03748                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahh  Aeromonas hydrophila AL06-06 Pathway ahh01100   Metabolic pathways ahh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RY45_17500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RY45_17500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJQ55796 LinkDB All DBs Position complement(3895196..3895462) Genome browser AA seq 88 aa AA seqDB search MQDLHLEIKQLIIDSLNLEGLTPDDIDSQAPLFGDGLGLDSIDALELGLAIKGRYGIVLS AEDENTRRHFASVTALVALVQAQSKGEA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaagacctgcatctagagataaaacaactcatcatcgatagcctcaacctcgagggg ctcacccctgacgacatcgacagtcaggcgccgctgttcggtgacggcctggggctggac tccatcgatgcgctggagctgggccttgccatcaagggccgctacggcatcgtgctctcc gccgaggatgaaaacacccgtcgtcattttgcctctgtcacggcgctggtcgccctggtg caggcccagtcgaaaggggaggcctga

DBGET integrated database retrieval system