KEGG   Aeromonas hydrophila AH10: VU14_10170Help
Entry
VU14_10170        CDS       T03886                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00071  Fatty acid degradation
ahi00280  Valine, leucine and isoleucine degradation
ahi00281  Geraniol degradation
ahi00310  Lysine degradation
ahi00362  Benzoate degradation
ahi00380  Tryptophan metabolism
ahi00410  beta-Alanine metabolism
ahi00640  Propanoate metabolism
ahi00650  Butanoate metabolism
ahi00903  Limonene and pinene degradation
ahi00930  Caprolactam degradation
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01120  Microbial metabolism in diverse environments
ahi01130  Biosynthesis of antibiotics
ahi01200  Carbon metabolism
ahi01212  Fatty acid metabolism
Module
ahi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VU14_10170 (fadJ)
   00650 Butanoate metabolism
    VU14_10170 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VU14_10170 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VU14_10170 (fadJ)
   00310 Lysine degradation
    VU14_10170 (fadJ)
   00380 Tryptophan metabolism
    VU14_10170 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VU14_10170 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VU14_10170 (fadJ)
   00281 Geraniol degradation
    VU14_10170 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VU14_10170 (fadJ)
   00930 Caprolactam degradation
    VU14_10170 (fadJ)
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VU14_10170 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VU14_10170 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VU14_10170 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AKA17211
LinkDB All DBs
Position
2274614..2276761
Genome map
AA seq 715 aa AA seqDB search
MSEKTFSLAVRQDGIGILTMDVPGESMNTLKAAFVEEIRAVLAEVKANKELIGLVVVSGK
KDSFIAGADISMLAACTSAKDAETLSREGQVIFAEIESLPIPVIAAIHGPCLGGGLELAL
ACHGRVITDHGKTVLGLPEVQLGLLPGSGGTQRLPRLIGVAKALDLMLTGKQVRAKQAKK
LGMVDDVVPPSILLDAAIKLAKKGKPRHELKRDLQGKLLETNKLGRKVLFDQARKGVKAK
TRGNYPAPDLILEVVRIGVEEGMQAGLAAESRHFGELVMTSESAALRSIFFATTEMKKEV
TYQGAEPRKVGHAAVLGGGLMGGGIAFVTATKAGVPVRIKDVASSGIGNAMRYSYDILAK
KLKRRQLLRSELEKQMSLLTGTLDYSGFHRVDMVVEAVFEDLSLKHQMVKDVERECGEHT
VFASNTSSLPIHQIASAAAHPERVVGLHYFSPVDKMPLAEIIPHAGTSAETVATTLAFAR
AQGKTPIVVKDEAGFYVNRILAPYMNEAARLVLEGEPVEVLDGALLDFGFPVGPITLLDE
VGIDVGAKISPILEKELGGEQFQAPAAFDKLLQNDRKGRKNGKGFYLYGKAAPRSKLTGK
EGKKTVDESVYGVLGISPQAKLAKAELAERCVLMMLNEAAMALDSGVVASARDGDIGAIF
GIGFPPFLGGPFRYMDSLGIEHLVGRLEHYQKRYGDRFAPCDRLKAMAAEQLRFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagactttttccctggcggtgcgccaggatggcatcggcattctcaccatg
gatgtgccgggcgagagcatgaataccctcaaggccgccttcgtggaggagatccgcgcg
gtgctggccgaggtgaaagccaataaagagctgatcggcctggtggtggtctccggcaag
aaggactccttcatcgccggcgccgacatcagcatgctggcggcctgtaccagcgccaag
gatgccgaaacgctgtcgcgggaagggcaggtgatcttcgccgagatcgagtcgctgccg
atcccggtgatcgccgccattcacggcccctgcctcggcggcgggctggagctggcgctg
gcctgccatggccgggtgatcaccgatcacggcaagacggtgctcggcctgcccgaggtg
caactgggcttgctgccgggctccggcgggacccagcgtctgccgcgcctcatcggggtg
gccaaggcactcgatctgatgctgaccggcaagcaggtgcgggccaagcaggccaagaaa
ctggggatggtggacgacgtggtgccgccctccatcctgctggatgcggccatcaagttg
gccaagaagggcaagccccgtcatgagctcaagcgggatctgcagggcaaactgctggag
accaacaagcttggccgcaaggtgctgttcgatcaggcccgcaaaggggtgaaagcgaag
acccgcggcaactacccggcgccggatctgatcctggaagtggtgcgcatcggggtggaa
gaggggatgcaggccggccttgccgccgaatcccgccactttggcgagttggtgatgacc
agcgaatcagccgccctgcgctccatcttctttgccaccaccgagatgaagaaggaggtc
acctatcagggggccgagccgcgcaaagtgggtcatgccgccgtgctgggcggcggtctg
atggggggcggtatcgccttcgtcaccgccaccaaggcaggcgtgccggtgcggatcaag
gacgtggccagcagcggcatcggcaatgccatgcgctacagctacgacatcctggccaag
aagctcaagcgccgccaactgctgcgcagcgagcttgagaagcagatgagcctgctcacc
ggcaccctcgactactccggtttccaccgggtcgacatggtggtggaggcggtgtttgaa
gatctttccctcaagcaccagatggtgaaggacgtggagcgcgagtgcggcgagcacacc
gtgtttgcctccaacacctcctctctgccgatccaccagatcgcctcggcggcagcgcac
ccggagcgggtggtggggctgcactacttcagcccggtggacaagatgccgctggcggag
atcatcccccacgccggcaccagtgccgagacggttgccaccaccctggcctttgcccgt
gctcagggcaagacccccatcgtggtcaaggatgaggcaggcttttacgtcaaccgcatc
ctggccccttacatgaacgaggcggcgcgtctggtgctggaaggggagccggtggaggtg
ctggacggcgccctgctcgatttcggcttcccggtcggccccatcaccttgctggacgag
gtggggatcgacgtgggtgccaagatctccccgatcctcgaaaaagagctggggggcgag
cagttccaggccccggcggcctttgacaagctgctgcaaaacgatcgcaaggggcgcaag
aacggcaagggcttctacctctacggcaaggcggccccgcgcagcaagcttaccggcaaa
gagggcaagaagacggtggacgagagcgtctacggtgtgctcggcatctcgccccaggcc
aagctggccaaggcagagctggccgagcgctgcgtgctgatgatgctcaacgaagcggcc
atggcgctggacagcggcgtggtggcctcggctcgcgatggcgacatcggcgccatcttc
ggcatcggcttcccgccgttcctgggtggcccgttccgctacatggacagtctcggcatc
gagcacctggtggggcgccttgagcactaccagaagcgctacggcgaccggttcgccccc
tgcgatcgcctcaaggcgatggcggcggagcagctgcgtttctattga

DBGET integrated database retrieval system