KEGG   Achromobacter insolitus: BUW96_18250Help
Entry
BUW96_18250       CDS       T04671                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ais  Achromobacter insolitus
Pathway
ais00020  Citrate cycle (TCA cycle)
ais00190  Oxidative phosphorylation
ais00650  Butanoate metabolism
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
ais01130  Biosynthesis of antibiotics
ais01200  Carbon metabolism
Module
ais_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ais_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ais_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUW96_18250 (sdhB)
   00650 Butanoate metabolism
    BUW96_18250 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUW96_18250 (sdhB)
Enzymes [BR:ais01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BUW96_18250 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BUW96_18250 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: APX76607
UniProt: A0A448K1R5
LinkDB All DBs
Position
complement(4004382..4005098)
Genome map
AA seq 238 aa AA seqDB search
MSTKRIVKFEIYRYDPDKDERPYMQKLEVELQPTDKMLLDALVRIKNDVDDSLALRRSCR
EGVCGSDAMNINGKNGLACTTNLRELKEPIVLRPLPGLPVIRDLIVDMTHFFNQYHSIRP
YLINDTPPPEKERLQSPEAREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYR
FIADSRDEATGSRLDSLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaagagaatcgtcaagttcgaaatctaccgctacgatccggacaaggacgag
cgcccctacatgcagaagctggaagtcgaactccagccgaccgacaagatgctgctcgat
gcgctggtgcgcatcaagaacgacgtcgatgacagcctggccctgcgccgctcgtgccgt
gaaggcgtgtgcggttcggacgccatgaacatcaacggcaagaacggcctggcgtgcacg
accaacctgcgcgaactgaaggaacccatcgttctgcgtccgctgccgggcctgcccgtc
atccgcgacctgatcgtggacatgacgcacttcttcaaccagtaccactcgatccgcccg
tacctcatcaacgacacgccgccgcccgaaaaggaacgcctgcagtcgcccgaggcgcgc
gaagagctggatggcctgtacgagtgcattctgtgcgcgtgctgttccacttcctgcccg
tcgttctggtggaatccggacaagttcgtcggcccggccggcctgctgcaagcctaccgc
ttcatcgccgacagccgcgacgaagccacgggcagccgtctggacagcctggatgatccg
taccgcctgttccgttgccacaccatcatgaactgcgtcgacgtctgtcccaagggactg
aacccgaccaaggcgattggcaagatcaaggaactgatggttcgccgtacggtctag

DBGET integrated database retrieval system