KEGG   Amycolatopsis japonica: AJAP_30100Help
Entry
AJAP_30100        CDS       T03225                                 

Definition
(GenBank) Hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aja  Amycolatopsis japonica
Pathway
aja03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aja00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AJAP_30100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aja03400]
    AJAP_30100
Enzymes [BR:aja01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AJAP_30100
DNA repair and recombination proteins [BR:aja03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AJAP_30100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIG78849
UniProt: A0A075V2P1
LinkDB All DBs
Position
complement(6409222..6410139)
Genome map
AA seq 305 aa AA seqDB search
MPEERITVEVEGRRLGLSNLDKVLYPAHGFTKREVLDYYRRIAPVMLPHLRDRAATFRRF
PDGVDGEPFYEKNVSRHAPDWVRTARLTNRGRRGGEETLDYPVVGDLPTLMWAANLAALE
LHIPQWTVGPRGARKSPDLLVFDLDPGPPADVVDCCRVAETLSDLLIGDGLTVYAKTSGN
KGMQLYCPVRTRSGERTSEYAKAVAEELARRSPETIVAKMTKAIRPGRVFIDWSQNNTAK
TTIAPYSLRGRAVPTVSTPVTWEEVEACRKAADLLFTAEQVLERVEEMGDLFGDIAEHRA
AVPQR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaggagcggataacggtcgaggtcgagggtcggcggctggggctgtccaatctg
gacaaggtgctctatcccgcgcacggtttcaccaaacgcgaggtcctcgactactaccgc
cggatagccccggtgatgctcccgcatctgcgcgaccgcgccgccaccttccgccggttc
cccgacggtgtcgacggcgaaccgttctacgagaagaacgtttcccgtcacgcgcccgac
tgggtgcgcaccgcgcggctcaccaaccgcggccgccggggcggggaggagacgctcgac
tacccggtcgtcggcgacctcccgacgctgatgtgggcggccaatctcgccgcgctggaa
ctgcacattccacagtggaccgtcggcccgcgcggcgcccggaaatcacccgatctgctg
gtgttcgacctcgatcccgggccgcccgcggacgtcgtcgactgctgccgggtggccgag
acgctcagcgacctgctcatcggagacggtctcacggtgtacgcgaagaccagcggcaac
aagggaatgcagttgtactgcccggtgcgcacgcgctccggcgaacgcacctccgagtac
gccaaggccgtcgcggaggagctcgcgcgccggtcaccggagaccatcgtcgccaagatg
acgaaggccatccgccctggccgcgtgttcatcgactggagccagaacaacaccgccaag
accaccatcgcgccgtactcattgcgcggccgcgccgtcccgaccgtctccacgccggtg
acctgggaggaggtcgaagcctgccgcaaggccgccgacctgctgttcaccgccgagcag
gtgctcgaacgcgtcgaggagatgggtgacctgttcggcgacatcgccgagcatcgcgcg
gccgtgccccaacggtga

DBGET integrated database retrieval system