KEGG   Acinonyx jubatus (cheetah): 106966982Help
Entry
106966982         CDS       T04657                                 

Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106966982
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    106966982
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106966982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 106966982
NCBI-ProteinID: XP_014918644
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MKFFLLLSVIGFCRAQYNPNTKPGRTSIVHLFEWRWADIALECERYLAPKGFGGVQISPP
NENVVINSPLRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVHIYVDAVINHMSGN
GVGAGTSSTCGSYFNPGNRDFPAVPFSHWDFNDGKCRTGSGDIENYNDPYQVRDCRLVGL
LDLALEKDYVRSKIAEYLNRLIDIGVAGFRIDASKHMWPGDMKAILDKLHNLNTNWFPEG
SKPFIYQEVIDLGGEPIKSNEYFGNGCVTEFKYGAKLGTVLRKWDGEKMAYLKNWGEGWG
FMRSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRVMSSFRWP
RHFENGKDVNDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQP
FRNWWDNGSNQVAFGRGNRGFIVFNNDDWPLSLTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYVSGDGNAHFSVSNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgctttcagtcattgggttctgcagggctcagtataacccaaat
accaagcctggacggacatctattgtccatctgtttgagtggcgctgggctgacattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcagatctctccaccc
aatgaaaatgttgtgattaatagccctttaagaccttggtgggaaagataccaaccagtt
agctacaagttatgcacaagatcaggaaatgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccatatttatgtggatgctgtaattaatcatatgagtgggaat
ggtgtgggtgcaggaacaagcagtacttgtggaagttacttcaaccctggaaatagagat
tttccagcagtcccattctctcattgggattttaatgatggtaaatgtagaactggaagt
ggagacattgagaactataatgatccttatcaggtcagagattgtcgtctggtcggtctt
cttgatcttgcactggagaaagattatgtgcgttctaagattgctgaatatctgaaccgc
ctcattgacattggtgtagcagggttcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggataaactgcataatctgaatacaaactggttccccgaagga
agtaaacccttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcaat
gagtactttggaaatggctgtgtgacagaattcaagtatggtgcaaaattaggcacagtt
ctgcgcaagtgggatggagagaagatggcttacttaaagaactggggagaaggatggggt
ttcatgcgttctgacagagcacttgtctttgtggacaatcatgacaatcagcgaggacat
ggagctggaggagcatctattctaacattctgggactccagactgtacaaaatggcagtt
ggatttatgcttgctcatccgtatggatttacacgagtaatgtcaagcttccgttggcca
agacattttgaaaatggaaaagatgttaatgattggattgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacaccacttgtggcaatgattgggtctgtgaa
catcggtggcgtcaaataaggaacatggttatgttccgtaatgtagttgatggccaacct
tttagaaactggtgggataatggtagcaatcaagtagcttttggaagaggaaacagagga
tttattgtttttaacaatgatgactggccattatctttaactttgcaaactggtcttcct
gctggcacatattgtgatgttatttctggagataaaattgatggcaattgtacaggaatt
aaaatttatgtttctggggatggcaatgctcatttttctgttagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system