KEGG   Acinonyx jubatus (cheetah): 106972381Help
Entry
106972381         CDS       T04657                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03410  Base excision repair
Module
aju_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:aju00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    106972381 (LIG3)
Enzymes [BR:aju01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106972381 (LIG3)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     106972381 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme HD_2
Motif
Other DBs
NCBI-GeneID: 106972381
NCBI-ProteinID: XP_014924847
LinkDB All DBs
Position
Un
AA seq 1003 aa AA seqDB search
MPLDESAHFVCMTLTFKILFLPTLRALGRKELCLFGEQHRWPDRRQFGHWSETELFHGHG
LLQRRKAVLSSQKGGLRPRVTHLVFLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKC
KEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEE
LEDNEKEQISQHIADLSSKATSTPKKKAVVQAKLTATGQVTSPVKGASFVTNTNPRKFSG
FAAKPNNSGEARSSPTPKASLSSSRCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQD
FLRKGSAGDGFHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQG
DVSETIRVFFEQSKSFPPAAKSLLTIQEVDAFLLRLSKLTKEDEQQQALQDIASRCTAND
LKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGRR
RALSVQASLMTPVQPMLAEACKSIEHAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSR
SLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDTKTGKPLPFGTLGVHKKAAFQDA
NVCLFVFDCIYFNDISLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKASDLADMINR
VIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMM
SIFLMGCYDPGSQKWCTVTKCSGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYY
PDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATDLPKLKEL
YQLSNFTVAAGDEGSSTTGGSSGENEVTSRPASRASPKQPSTSAKKAGGRRSSPNSRGGS
KPTAKPPPVRVGEKRKAPDEPPGQAKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDL
VQEFDMASATHVLGSRDENPEAQQVSPEWIWACIRKRRLVAPC
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgccccttgatgaatctgcgcactttgtctgtatgactttgactttcaagatcctcttc
ctcccaaccctccgcgcacttgggcgaaaagaactctgcctcttcggagaacaacatcgc
tggcctgacagaagacagttcggccattggtcagaaacagagctgtttcatgggcacggc
ctcctccagagaagaaaggccgttctgtcatcccagaaaggcggtctaagaccacgtgtc
acccaccttgttttcttgccagggtcgcatgtgggactctgcagtggcccctgtgagatg
gccgagcaacggttctgtgtggactacgccaagcgtggcacggccggctgcaaaaagtgc
aaggaaaagatcgtgaagggcgtatgccggatcggcaaagtggtgcccaaccccttctca
gagtccgggggcgatatgaaagagtggtatcacattaaatgcatgttcgagaaactggag
cgggcccgggccaccacaaaaaaaattgaggacctcaccgagctggaaggctgggaagag
ctggaagataatgagaaggaacagataagccagcacattgcagatttgtcttccaaggca
acaagcacaccaaagaagaaagctgttgtccaggctaagctgacagccactggccaggtg
acgtctccagtgaaaggtgcctcatttgtcaccaataccaatcctcggaaattttctggt
tttgcagccaagcccaacaactctggggaagcccgctcaagccctacccctaaggcaagc
ctgtcctcaagcagatgtgaccccaagcacaaggattgtctgctacgtgagtttcggaag
ttgtgtgccatggtggctgaaaatcctagctacaacacgaagacccagatcatacaggac
tttcttcggaaaggttcagcaggagatggtttccacggtgacgtgtacctaacagtgaag
ctgctgctgccaggtgttattaagagtgtttacaacttgaacgataagcagattgtgaag
cttttcagccgcatttttaactgcaacccagatgatatggcacgagacctagagcagggt
gacgtgtcagagacgatcagagtcttctttgagcagagcaagtctttccctccagctgcc
aagagcctcctcaccatccaagaggtagatgcgttcctccttcgcctctccaagctcacc
aaggaggatgagcaacagcaggccctgcaggacatcgcgtccaggtgtacagccaacgac
cttaagtgcatcatcagattgatcaaacatgacctgaagatgaactcaggtgcaaaacac
gtgttagatgcccttgaccccaatgcctatgaagccttcaaagcctcacgcaacctgcag
gatgtggtggagcgagtcctccgcaatgagcaggaggtggagaaggagccaggccggaga
cgagctctgagtgtccaggcttcactgatgacgccagtgcagcccatgctggccgaggcc
tgcaagtccatcgaacatgcgatgaagaagtgtcctaatggcatgttctctgagatcaag
tatgacggggagcgagtccaggtgcataagaatggagaccacttcagctacttcagccgc
agcctcaagcccgttctgcctcacaaggtggcccactttaaggactatatcccccaggct
ttccctgggggccacagcatgatcttggactctgaggtgctcctgatcgacactaagaca
ggcaaaccgttgccctttgggactcttggggtgcacaagaaagctgccttccaggatgct
aacgtctgcctgtttgtttttgattgtatctacttcaatgacatcagcttgatggacagg
cctctgtgtgagcggcggaagtttcttcatgataacatggttgaaattcccaaccggatc
atgttctcagaaatgaagcaagtcactaaagcttcggacttggccgacatgataaaccgg
gtcatccgagaggggttggaagggctggtgctgaaggacgtgaagggtacatatgagcct
ggaaagcggcactggctgaaagtcaagaaagactatttgaatgagggggccatggctgac
acagctgacctggtggtccttggggccttctatgggcaagggagcaaaggtggcatgatg
tccatcttcctcatgggctgctatgacccaggcagccagaagtggtgcacggtcaccaag
tgttcgggaggccatgatgatgcgacgcttgcccgcctgcagaaggaactggacatggtg
aagatcagtaaggatcccagcaagatacccagctggctgaaaatcaacaagatctactac
ccggacttcatagttccagacccaaagaaagctgccgtgtgggagatcacaggggctgag
ttctccaaatctgaggctcacacggccgacggaatctccatccgattccctcgttgcacc
cggatccgtgatgataaggactggaaatctgccactgacctccccaaactcaaggaactg
taccagctgtccaacttcacggtggcagccggagacgaggggagctccactactgggggc
agcagcggagagaacgaggttacctcgcggcctgcctccagggcctccccgaagcagccc
tccaccagtgccaagaaggcaggagggaggcggagcagccccaacagccgaggtggtagc
aagcccacagcgaagcctccccccgtgagagtgggagagaagcggaaggctcccgacgag
cccccgggccaagcaaaggtgctgctggacatcttcactggggtgcggctctacctgcca
ccctccacgccggacttcagccgtctcagacgctactttgtggcattcgatggggacctg
gtgcaggaatttgacatggcttcggccacgcacgtgctggggagcagggacgagaaccct
gaggcccagcaggtctccccggagtggatctgggcgtgtatccggaaacggaggctggta
gctccctgctag

DBGET integrated database retrieval system