KEGG   Acinonyx jubatus (cheetah): 106982840
Entry
106982840         CDS       T04657                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04932  Non-alcoholic fatty liver disease
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05017  Spinocerebellar ataxia
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05134  Legionellosis
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05222  Small cell lung cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106982840
   04215 Apoptosis - multiple species
    106982840
   04115 p53 signaling pathway
    106982840
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106982840
  09162 Cancer: specific types
   05210 Colorectal cancer
    106982840
   05222 Small cell lung cancer
    106982840
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106982840
   05012 Parkinson disease
    106982840
   05014 Amyotrophic lateral sclerosis
    106982840
   05016 Huntington disease
    106982840
   05017 Spinocerebellar ataxia
    106982840
   05020 Prion disease
    106982840
   05022 Pathways of neurodegeneration - multiple diseases
    106982840
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106982840
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106982840
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106982840
   05134 Legionellosis
    106982840
   05152 Tuberculosis
    106982840
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106982840
   05161 Hepatitis B
    106982840
   05160 Hepatitis C
    106982840
   05164 Influenza A
    106982840
   05162 Measles
    106982840
   05168 Herpes simplex virus 1 infection
    106982840
   05163 Human cytomegalovirus infection
    106982840
   05167 Kaposi sarcoma-associated herpesvirus infection
    106982840
   05169 Epstein-Barr virus infection
    106982840
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106982840
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106982840
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 106982840
NCBI-ProteinID: XP_014936499
UniProt: A0A6J0A3J4
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

KEGG   Acinonyx jubatus (cheetah): 106986613
Entry
106986613         CDS       T04657                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04932  Non-alcoholic fatty liver disease
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05017  Spinocerebellar ataxia
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05134  Legionellosis
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05222  Small cell lung cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106986613
   04215 Apoptosis - multiple species
    106986613
   04115 p53 signaling pathway
    106986613
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106986613
  09162 Cancer: specific types
   05210 Colorectal cancer
    106986613
   05222 Small cell lung cancer
    106986613
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106986613
   05012 Parkinson disease
    106986613
   05014 Amyotrophic lateral sclerosis
    106986613
   05016 Huntington disease
    106986613
   05017 Spinocerebellar ataxia
    106986613
   05020 Prion disease
    106986613
   05022 Pathways of neurodegeneration - multiple diseases
    106986613
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106986613
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106986613
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106986613
   05134 Legionellosis
    106986613
   05152 Tuberculosis
    106986613
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106986613
   05161 Hepatitis B
    106986613
   05160 Hepatitis C
    106986613
   05164 Influenza A
    106986613
   05162 Measles
    106986613
   05168 Herpes simplex virus 1 infection
    106986613
   05163 Human cytomegalovirus infection
    106986613
   05167 Kaposi sarcoma-associated herpesvirus infection
    106986613
   05169 Epstein-Barr virus infection
    106986613
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106986613
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106986613
SSDB
Motif
Pfam: Cytochrom_C
Other DBs
NCBI-GeneID: 106986613
NCBI-ProteinID: XP_026890797
UniProt: A0A6J1XE98
LinkDB
Position
Unknown
AA seq 93 aa
MGDVEQGKIFVQKCAQRHDAEKGGKHKTGPNLHGLFGWKAGQTPGFSYMDANQTKGTSWG
EETLMKYLENPKKYIPETKMIFAGIKKARERAD
NT seq 282 nt   +upstreamnt  +downstreamnt
atgggtgacgttgagcagggcaagatttttgttcagaagtgtgcccagcgccatgacgcg
gaaaagggcggcaagcacaagactgggccaaatctccatggtttatttgggtggaaggca
ggtcaaacccctggattttcttacatggatgccaaccagaccaaaggcacctcctgggga
gaggagacactgatgaagtatttggagaatcccaagaagtacatccctgaaacaaaaatg
atctttgctggcattaagaaggcaagggaaagagcagactag

KEGG   Acinonyx jubatus (cheetah): 106988781
Entry
106988781         CDS       T04657                                 

Definition
(RefSeq) cytochrome c, testis-specific-like
  KO
K08738  cytochrome c
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04932  Non-alcoholic fatty liver disease
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05017  Spinocerebellar ataxia
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05134  Legionellosis
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05222  Small cell lung cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106988781
   04215 Apoptosis - multiple species
    106988781
   04115 p53 signaling pathway
    106988781
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988781
  09162 Cancer: specific types
   05210 Colorectal cancer
    106988781
   05222 Small cell lung cancer
    106988781
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106988781
   05012 Parkinson disease
    106988781
   05014 Amyotrophic lateral sclerosis
    106988781
   05016 Huntington disease
    106988781
   05017 Spinocerebellar ataxia
    106988781
   05020 Prion disease
    106988781
   05022 Pathways of neurodegeneration - multiple diseases
    106988781
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106988781
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106988781
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106988781
   05134 Legionellosis
    106988781
   05152 Tuberculosis
    106988781
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106988781
   05161 Hepatitis B
    106988781
   05160 Hepatitis C
    106988781
   05164 Influenza A
    106988781
   05162 Measles
    106988781
   05168 Herpes simplex virus 1 infection
    106988781
   05163 Human cytomegalovirus infection
    106988781
   05167 Kaposi sarcoma-associated herpesvirus infection
    106988781
   05169 Epstein-Barr virus infection
    106988781
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106988781
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106988781
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3
Other DBs
NCBI-GeneID: 106988781
NCBI-ProteinID: XP_026899741
UniProt: A0A6J1Y486
LinkDB
Position
Unknown
AA seq 119 aa
MVDVFIAESKDRRGDAKAGEKIFIQKCAQCHTVEKGGKHKTGPNLWGLSGPGRKTGQAPG
FSFSDANKNRGIIWGEETLIEYLENPKEYIPGTKMVFAGLKKKSERDDLIQYLKQATSS
NT seq 360 nt   +upstreamnt  +downstreamnt
atggtagatgtgtttatagctgagagtaaagatagaaggggagatgctaaagcaggtgag
aagatctttattcagaaatgtgctcagtgccacacagtggaaaaaggtggaaaacacaag
actggtccaaatctctggggcctttctggccctggacgaaaaacaggacaagcaccagga
ttttctttttccgatgctaacaaaaacagaggtattatctggggagaggaaactctgata
gaatatttagagaacccaaaggaatatatccctggaactaaaatggtctttgctggtctt
aaaaagaagagtgagagagatgatcttattcagtatttgaaacaggcaacatcttcatga

DBGET integrated database retrieval system