KEGG   Acinonyx jubatus (cheetah): 106984382
Entry
106984382         CDS       T04657                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00220  Arginine biosynthesis
aju00330  Arginine and proline metabolism
aju01100  Metabolic pathways
aju04020  Calcium signaling pathway
aju04066  HIF-1 signaling pathway
aju04146  Peroxisome
aju04371  Apelin signaling pathway
aju04926  Relaxin signaling pathway
aju05010  Alzheimer disease
aju05014  Amyotrophic lateral sclerosis
aju05022  Pathways of neurodegeneration - multiple diseases
aju05133  Pertussis
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05145  Toxoplasmosis
aju05146  Amoebiasis
aju05152  Tuberculosis
aju05200  Pathways in cancer
aju05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106984382 (NOS2)
   00330 Arginine and proline metabolism
    106984382 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106984382 (NOS2)
   04066 HIF-1 signaling pathway
    106984382 (NOS2)
   04020 Calcium signaling pathway
    106984382 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106984382 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106984382 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106984382 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    106984382 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106984382 (NOS2)
   05014 Amyotrophic lateral sclerosis
    106984382 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    106984382 (NOS2)
   05152 Tuberculosis
    106984382 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106984382 (NOS2)
   05145 Toxoplasmosis
    106984382 (NOS2)
   05140 Leishmaniasis
    106984382 (NOS2)
   05142 Chagas disease
    106984382 (NOS2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106984382 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 106984382
NCBI-ProteinID: XP_026890279
UniProt: A0A6J1XCR5
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQFLFKAKSHQYNLTEETDINNNVGKAVRAPSGLVTQDDPKCHSLSKHRNEPPQSL
TGTVKTVPESLGKLDMPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACRSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGGDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFFYYQVEAWKTHIWQDEKRRPRRRKIPFKVLVQAVLFASMLMRKTMASRVRAT
ILFATETGKSETLARDLGALFSCAFNPKILCMDQYGLSNLEEEQLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVRGKHRVQIPKLYTSNVTWDPHHYRLMRDSQPLDL
SKALGSMHAKNVFTMRLKSQRNLQSAKSSRTTLLVELSCEDSHRLSYLPGEHLGVFPGNQ
LALVKGILERVVDGPAPHQPVHLETLSESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAERQRLEILCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRACAPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSAGGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDAEHKGLRGSRMTLVFGCRRPD
EDHLYREEMLEMAQKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQGHLY
VCGDVRMARDVAQTLKHLLAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AARQPSDPRVPAAHGTS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcccaccagtacaacttgactgag
gaaacagacatcaacaacaatgtggggaaggccgtccgggccccctctggtctagtgaca
caggatgaccccaagtgtcacagcctcagcaaacaccggaatgagcccccccagtccctc
acggggacagtaaagacagttccagaatccctggggaagctggatatgcccccgtcggcc
tgcccacggcacgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccacaaggccaaaggggatcttgcttgcaggtctaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacccccccagatgagcttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggagatgagctcatcttcgccaccaagcaggcttggcgcaatgccccccgctgc
atcgggaggatccagtggtcaaacctacaggtcttcgacgcccggagctgttccactgcc
caggaaatgttcgagcacatctgcagacacgtgcgttatgctaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatgggaagcatgacttccggatctgg
aatgctcagctcatccggtatgctggctaccagatgcctgatggcaccatcctgggggac
cctgccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgctttgatgtggtgcctctggtcctgcaggctgatggcggagaccctgagctctttgaa
atcccgcctgacctcgtgctcgaggtgcccatggaacatcccaagtatgagtggttccgt
gaactggagctaaagtggtatgccctgcctgccgtggccaacatgctgctcgaggtgggt
ggcctggagttcccagggtgccccttcaacggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgttcagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcactctggaaggaccgggctgtcattgagatcaacgtc
gccgtgctgcacagtttccagaagcaaaacgtgaccatcatggaccaccactcggctgcg
gagtccttcatgaagtacatgcagaacgagtaccggtcccgagggggctgtcctgccgac
tggatttggctggtgcccccgatttctggcagcatcactcccgtgttccaccaggagatg
ttaaactatgtcctgtcccctttcttctactaccaggtggaggcctggaaaacccacatc
tggcaggatgagaagcggagaccccggagaagaaagattccgttcaaagtcttggttcaa
gctgtgctcttcgcctccatgctgatgcgcaagaccatggcgtcccgagtgagagccaca
atcctctttgcgacggagacaggaaagtcagaaacactggcccgggacctaggggccttg
ttcagctgtgccttcaaccccaagattctctgcatggaccagtacgggctgagcaacctg
gaggaagagcagctactactggtggtgaccagcacgtttgggaacggagactgccccggc
aacggagagaaactgaaaaaatccctcttcatgctgaaagagcttaccaacaagttcagg
tatgccgtgttcggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagctgtcccatctgggggcctctcagcttgccccaacaggggaaggggac
gagctcagtggacaggaggaagccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtgcgaggcaagcaccgcgttcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcatgcgggactcacagcctctggacctc
agcaaagccctcggcagtatgcacgccaagaacgtgttcaccatgaggctcaaatcacag
cggaatctccagagtgcgaaatccagccgcaccaccctcctggtggagctctcctgtgag
gacagccaccggctgagctacctgcctggagagcacctcggggttttcccaggcaaccag
ctggctctggtaaaaggcatcttggagcgagtggtggacggccctgcgccccaccaaccg
gtgcacctggagaccctcagcgagagcggaagctactgggtcagagacaagcggctgccc
ccgtgctcgctcagccaggccctcacctacttcctggatatcaccacccccccaacccag
ctgctgctccgcaaattggcacagctggccacagaagaggcagagaggcagaggctggag
atcctgtgccagccctcagagtacaacaaatggaagttcaccaatagccccacattcctg
gaggtactggaggagttcccatccctgcgggtatctgctggcttcctgctctcccagctg
cctattctgaaaccccggtactactccatcagctcctccagggcctgtgcacccacggag
gtccacctcactgtggctgtgctcacctaccgcacccgagatggccaaggtcccttgcac
cacggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtaccctgcttt
gtgagaagtgccggcggcttccagctccctgaggacccctcccaaccttgcatcctcatt
gggcctggcacaggcatcgcccccttccgcagcttctggcagcagcggctccatgatgct
gagcacaaagggctccggggcagccgcatgaccctggtgttcgggtgccgccgcccggat
gaggaccacctctatcgggaggagatgttggagatggcccagaagggggtgctgcatgag
gttcacacagcctactctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
aggcagcagctggccagcgaggtgctccgcgtgctccatgaggagcaaggccacctttat
gtctgtggggatgtgcgtatggcccgggatgtggcccaaaccctgaagcacctgctggcc
gccaagctgagcctgagcgaggagcaggtggaggactatttcttccaacttaagagccag
aagcgctatcatgaagacatctttggtgctgtatttccctacgaggtgaaaaaggatggg
gcagcaaggcagcccagcgatcccagagttccagcggcccacgggacaagttaa

DBGET integrated database retrieval system