KEGG   Acinonyx jubatus (cheetah): 106986637Help
Entry
106986637         CDS       T04657                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00590  Arachidonic acid metabolism
aju01100  Metabolic pathways
aju04611  Platelet activation
aju04726  Serotonergic synapse
aju04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106986637 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106986637 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    106986637 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    106986637 (PTGS1)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106986637 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 106986637
NCBI-ProteinID: XP_026890840
LinkDB All DBs
Position
Unknown
AA seq 602 aa AA seqDB search
MSRRSRLLRFPLLLLLLLLQPPQVLPADSRAPAPVNPCCYYPCQHQGICVRFGLDRYQCD
CTRTGYSGPNCTIPELWTWLRNSLRPSPAFLHFLLTHGRWFWEFVNATFIRDMLMRLVLT
VRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAQILG
HRFLLRRTFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNL
ERQYQLRLFKDGKLKYQVLHGEMYPPSVEEAPVLMHYPRNIPPQSQMAVGQEVFGLLPGL
MLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQ
LKFDPELLFGVQFQYRNRIAMEFNQLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYG
VEALVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIKESRELRLQPFNEYRKRFGLRPYTSF
QELTGEKEMAAELEELYGDIDALEFFPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNP
ICSPEYWKPSTFGGEMGFNMVKTATLKKLVCLNTKTCPYVSFHVPDPRQDDGPGVERPSK
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaggagtcgtttgctccggttcccgctgctcctgctgctgctgctgctgcag
ccgccccaggtcctgcccgcggattcccgggcccccgcgccggtgaatccatgctgttac
tacccatgccaacaccaggggatctgtgtccgcttcggccttgaccgctaccagtgtgac
tgcacccgcacgggatattctggccccaactgcaccatccccgagctatggacctggctc
cggaattcactgcgacccagccccgctttcctccacttcctgctgacacatgggcgctgg
ttctgggagtttgtcaatgccactttcatccgagacatgctcatgcgcctggtactcaca
gtgcgttccaaccttatccccagccctcccacctacaacatagcgcatgactacatcagc
tgggagtccttctccaacgtgagctattatactcgtattctgccctctgtgccccaagac
tgccccacgcccatgggaaccaaagggaagaagcagttgccagatgcccagattctgggc
catcgcttcctgctcaggaggacgttcatacctgacccccaaggaaccaacctcatgttc
gccttctttgcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcct
ggcttcaccaaggccttgggacacggggtagatctcggccacatttatggggacaacctg
gaacgtcagtatcagctgcggctctttaaggatgggaaactcaaataccaggtgctgcac
ggagagatgtacccgccatcggtggaggaggcgccggtgttgatgcactacccacgaaac
attccaccccagagccagatggctgtgggtcaggaggtgtttgggctgcttcccgggctc
atgctctatgccacgctctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggct
gagcaccccacctggggtgatgagcaactcttccagacggcccgcctcatccttatcggg
gagaccatcaagattgtgattgaggagtatgtgcagcagttgagcggttacttcctgcag
ctgaagtttgacccggagctgctgttcggcgtccagttccagtaccgaaaccgcattgcc
atggagttcaaccagctgtaccactggcacccgctcatgcctgactccttcaaggtgggc
tcccgggagtacagctacgagcagttcctgttcaacacctccatgctggtggactatggg
gtcgaggccctggtggacgccttctctcgccagagcgctggccggattggtgggggtaga
aacatggaccaccatgtcttgcatgtggctgtcgatgtcatcaaggaatcccgtgagctg
cggctgcagcccttcaatgaataccgcaagaggttcggcctgagaccctacacgtccttt
caggagctcacaggagagaaggagatggcagctgagttggaggagctgtatggagacatt
gatgccttggagttcttcccagggctgcttctggagaagtgccatccaaattccatcttt
ggggagagtatgatagaaattggggcccccttttctctcaagggcctcctagggaatccc
atctgttctccagagtattggaagccaagcacatttggtggtgagatgggcttcaatatg
gtcaagacagccacgctgaagaagttggtctgcctcaacaccaagacttgtccctacgtt
tccttccatgtgcccgacccccgccaggatgatgggcctggtgtggagcggccatctaaa
gagctctga

DBGET integrated database retrieval system