KEGG   Altererythrobacter sp. B11: AEB_P3572Help
Entry
AEB_P3572         CDS       T05671                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alb  Altererythrobacter sp. B11
Brite
KEGG Orthology (KO) [BR:alb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AEB_P3572
Enzymes [BR:alb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AEB_P3572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase Thi4 DAO NAD_binding_7 Spermine_synth FAD_binding_3 NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: BBC74440
UniProt: A0A2Z5Z2B4
LinkDB All DBs
Position
3822176..3823765
Genome map
AA seq 529 aa AA seqDB search
MLDATMTQQLKTYLGNLREPIELVASLGDDAKSAQTRELLEEIAALSDKVSASFDGDNDR
RPSFVIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVEQDVLDQIAALEGDYN
FEMYFSLSCHNCPDVVQALTLMALNNSRITATLIEGGAFQSEVEARNVLAVPATFLNGEM
FASGKMGVEEIIAKLDGNAHARAAAKLAEKAPFEVLVVGGGPAGASAAIYTARKGFRTGV
AAERFGGQVLDTMGIENFISVPYTEGPKLAAALEAHVAEYDIDVMNLQKAEKLIPASAPG
GLHEVVFENGASLKARSLVLSTGARWRNLGVPGEFEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLVEFDSKLRADQVLQDKLRSLKNVDILVSAQTTEVTGD
GERVNGLVYKNRETGEERKVELEGVFVQIGLVPNTEWLKDSGVELTRFGEIAVDGKAATN
LPGVFAAGDCTTVPYKQIIIAMGEGSKAALSAFDYLIRNEAVEEIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccactatgacgcaacagctcaagacctatctcggcaatctgcgcgagccg
atcgagctcgtcgcctcgcttggcgacgatgcgaagtccgcccagacgcgcgagctgctg
gaagagatcgccgcactgagcgacaaggtttccgccagtttcgacggtgacaacgatcgc
cggcccagcttcgtcatccgccgcgcatccgacgcggaaaagtgggtgcgcttcgccggc
ctgcccatggggcacgaattcaccagcctggtgctggccctgctgtgggccggcggccat
ccgcccaaggtggagcaggacgtgctggaccagatcgccgcgctggaaggcgactataat
ttcgagatgtatttctcgctcagctgccacaactgccccgacgtggtgcaggcgctgacg
ctgatggcgctcaacaattcgcgcatcacggccacgctgatcgaaggcggcgccttccag
agcgaggtggaagcgcgcaacgtgctggccgtgcccgccaccttcctcaatggcgagatg
ttcgccagcgggaagatgggcgtggaggaaatcatcgccaagctggacggcaatgcccat
gcccgggcggcggccaagctggcggagaaggccccgttcgaggttctggtggtcggcggc
gggccggccggcgcctcggccgcgatctacaccgcgcgcaagggcttccgcaccggcgtg
gcggcggagcggttcggcgggcaggtgctcgataccatgggaatcgagaacttcatttcc
gtgccttacaccgaaggcccgaagctcgccgccgcgctggaagcgcatgtggccgaatat
gacatcgacgtgatgaacctgcagaaggcggagaagctgatcccggcttcggcgccgggc
ggcctgcacgaagtggtgttcgaaaacggcgcctcgctgaaagcgcggtccctcgtgctc
tccaccggtgcacgctggcgcaacctgggcgtgccgggcgagttcgaatatcgcaaccgc
ggcgtcgcctattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaattccggcgtcgaagcggcgatcgaccttgcaaacatcgtcggccat
gtgacgctggtggaattcgacagcaagctgcgcgccgaccaggtgctgcaggacaagctg
cgcagcctcaagaacgtcgacatcctcgtctccgcccagaccaccgaggtgacgggcgac
ggcgagcgggtgaacggcctcgtctacaagaaccgcgagacgggtgaggagcgcaaggtg
gagctggagggcgtgttcgtccagatcggcctggtgcccaacaccgaatggctcaaggat
tccggcgtggagctgacccgcttcggcgagatcgcggtggacggcaaggcggccaccaat
ctgcccggcgtgttcgcggcgggcgattgcaccaccgtgccttacaagcagatcatcatc
gccatgggcgaaggctccaaggcggcgctgtccgccttcgattacctgatccgcaacgag
gcggtggaagagatcgcgcaggcggcctga

DBGET integrated database retrieval system